• Gene id: 926

Gene Summary

• Gene Symbol: CD8B   Gene   UCSC   Ensembl
• Aliases: CD8B1, LEU2, LY3, LYT3, P37
• Gene name: CD8b molecule
• Alternate names: T-cell surface glycoprotein CD8 beta chain, CD8 antigen, beta polypeptide 1 (p37), T lymphocyte surface glycoprotein beta chain,
• Gene location: 2p11.2 (86861923: 86815336)     Exons: 8     NC_000002.12
• Gene summary(Entrez): The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen, acting as a coreceptor, and the T-cell receptor on the T lymphocyte recognize an
• OMIM: 613210

Protein Summary

• Protein general information: P10966  
  • Name: T cell surface glycoprotein CD8 beta chain (CD antigen CD8b)
  • Length: 210  
  • Mass: 23722
  • Tissue specificity: Isoform 1, isoform 3, isoform 5, isoform 6, isoform 7 and isoform 8 are expressed in both thymus and peripheral CD8+ T-cells. Expression of isoform 1 is higher in thymus CD8+ T-cells than in peripheral CD8+ T-cells. Expression of isofo
• Sequence:

  MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDS
  AKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTL
  KKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQFYK

• Structural information:
  • Protein Domains: (22..13-)
    (/note="Ig-like-V-type")
  • Interpro: IPR042414  IPR007110  IPR036179  IPR013783  IPR003599   IPR013106  
  • Prosite: PS50835
  • STRING: ENSP00000331172
• Other Databases: GeneCards:  CD8B  Malacards:  CD8B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009986	cell surface	IBA	cellular component
GO:0050776	regulation of immune response	IEA	biological process
GO:0015026	coreceptor activity	IEA	molecular function
GO:0042288	MHC class I protein binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050690	regulation of defense response to virus by virus	TAS	biological process
GO:0031901	early endosome membrane	TAS	cellular component
GO:0031901	early endosome membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0042101	T cell receptor complex	NAS	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	NAS	biological process
GO:0006955	immune response	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0042110	T cell activation	NAS	biological process
GO:0042288	MHC class I protein binding	NAS	molecular function
GO:0015026	coreceptor activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules
hsa04660	T cell receptor signaling pathway
hsa04640	Hematopoietic cell lineage
hsa04612	Antigen processing and presentation
hsa05340	Primary immunodeficiency

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq