• Gene id: 92579

Gene Summary

• Gene Symbol: G6PC3   Gene   UCSC   Ensembl
• Aliases: SCN4, UGRP
• Gene name: glucose-6-phosphatase catalytic subunit 3
• Alternate names: glucose-6-phosphatase 3, G-6-Pase 3, G6Pase 3, G6Pase-beta, glucose 6 phosphatase, catalytic, 3, ubiquitous glucose-6-phosphatase catalytic subunit-related protein, ubiquitously expressed G6Pase catalytic subunit-related protein,
• Gene location: 17q21.31 (44070699: 44076343)     Exons: 8     NC_000017.11
• Gene summary(Entrez): This gene encodes the catalytic subunit of glucose-6-phosphatase (G6Pase). G6Pase is located in the endoplasmic reticulum (ER) and catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the last step of the gluconeogenic and glycogeno
• OMIM: 611045

Protein Summary

• Protein general information: Q9BUM1  
  • Name: Glucose 6 phosphatase 3 (G 6 Pase 3) (G6Pase 3) (EC 3.1.3.9) (Glucose 6 phosphatase beta) (G6Pase beta) (Ubiquitous glucose 6 phosphatase catalytic subunit related protein)
  • Length: 346  
  • Mass: 38,735
• Sequence:

  MESTLGAGIVIAEALQNQLAWLENVWLWITFLGDPKILFLFYFPAAYYASRRVGIAVLWISLITEWLNLIFKWFL
  FGDRPFWWVHESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGAALWPIMTALSSQVATRARSRWVRVMPSLAY
  CTFLLAVGLSRIFILAHFPHQVLAGLITGAVLGWLMTPRVPMERELSFYGLTALALMLGTSLIYWTLFTLGLDLS
  WSISLAFKWCERPEWIHVDSRPFASLSRDSGAALGLGIALHSPCYAQVRRAQLGNGQKIACLVLAMGLLGPLDWL
  GHPPQISLFYIFNFLKYTLWPCLVLALVPWAVHMFSAQEAPPIHSS

• Structural information:
  • Interpro: IPR016275  IPR036938  IPR000326  
  • STRING: ENSP00000269097
• Other Databases: GeneCards:  G6PC3  Malacards:  G6PC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004346	glucose-6-phosphatase activity	EXP	molecular function
GO:0004346	glucose-6-phosphatase activity	IMP	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006094	gluconeogenesis	IBA	biological process
GO:0006094	gluconeogenesis	IEA	biological process
GO:0015758	glucose transport	TAS	biological process
GO:0015760	glucose-6-phosphate transport	IEA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016311	dephosphorylation	IEA	biological process
GO:0030176	integral component of endoplasmic reticulum membrane	IBA	cellular component
GO:0051156	glucose 6-phosphate metabolic process	IBA	biological process
GO:0004346	glucose-6-phosphatase activity	IEA	molecular function
GO:0004346	glucose-6-phosphatase activity	IEA	molecular function
GO:0004346	glucose-6-phosphatase activity	IEA	molecular function
GO:0004346	glucose-6-phosphatase activity	EXP	molecular function
GO:0004346	glucose-6-phosphatase activity	IMP	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006094	gluconeogenesis	IEA	biological process
GO:0006094	gluconeogenesis	IBA	biological process
GO:0006094	gluconeogenesis	IEA	biological process
GO:0006094	gluconeogenesis	IEA	biological process
GO:0006796	phosphate-containing compound metabolic process	IEA	biological process
GO:0015758	glucose transport	TAS	biological process
GO:0015760	glucose-6-phosphate transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016311	dephosphorylation	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0030176	integral component of endoplasmic reticulum membrane	IBA	cellular component
GO:0051156	glucose 6-phosphate metabolic process	IEA	biological process
GO:0051156	glucose 6-phosphate metabolic process	IBA	biological process
GO:0004346	glucose-6-phosphatase activity	EXP	molecular function
GO:0004346	glucose-6-phosphatase activity	IMP	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006094	gluconeogenesis	IBA	biological process
GO:0015758	glucose transport	TAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0030176	integral component of endoplasmic reticulum membrane	IBA	cellular component
GO:0051156	glucose 6-phosphate metabolic process	IBA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04068	FoxO signaling pathway
hsa04151	PI3K-Akt signaling pathway
hsa04152	AMPK signaling pathway
hsa04910	Insulin signaling pathway
hsa04922	Glucagon signaling pathway
hsa04920	Adipocytokine signaling pathway
hsa04973	Carbohydrate digestion and absorption
hsa04931	Insulin resistance

Diseases

Associated diseases	References
Testicular failure	MIK: 24796372
Male factor infertility	MIK: 24796372
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Testicular failure	MIK: 24796372
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24796372	Testicular failure	Deletion mutation in G6PC3			Male infertility
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray