• Gene id: 92558

Gene Summary

• Gene Symbol: BICDL1   Gene   UCSC   Ensembl
• Aliases: BICDR-1, BICDR1, CCDC64, CCDC64A, H_267D11.1
• Gene name: BICD family like cargo adaptor 1
• Alternate names: BICD family-like cargo adapter 1, BICD-related protein 1, bicaudal D-related protein 1, coiled-coil domain containing 64, coiled-coil domain-containing protein 64A,
• Gene location: 12q24.23 (119989235: 120094494)     Exons: 15     NC_000012.12
• OMIM: 604982

Protein Summary

• Protein general information: Q6ZP65  
  • Name: BICD family like cargo adapter 1 (Bicaudal D related protein 1) (BICD related protein 1) (BICDR 1) (Coiled coil domain containing protein 64A) (CCDC64A)
  • Length: 573  
  • Mass: 64841
• Sequence:

  MSAFCLGLVGRASAPAEPDSACCMELPAAAGDAVRSPAAAAALIFPGGSGELELALEEELALLAAGERPSDPGEH
  PQAEPGSLAEGAGPQPPPSQDPELLSVIRQKEKDLVLAARLGKALLERNQDMSRQYEQMHKELTDKLEHLEQEKH
  ELRRRFENREGEWEGRVSELESDVKQLQDELERQQIHLREADREKSRAVQELSEQNQRLLDQLSRASEVERQLSM
  QVHALREDFREKNSSTNQHIIRLESLQAEIKMLSDRKRELEHRLSATLEENDLLQGTVEELQDRVLILERQGHDK
  DLQLHQSQLELQEVRLSCRQLQVKVEELTEERSLQSSAATSTSLLSEIEQSMEAEELEQEREQLRLQLWEAYCQV
  RYLCSHLRGNDSADSAVSTDSSMDESSETSSAKDVPAGSLRTALNELKRLIQSIVDGMEPTVTLLSVEMTALKEE
  RDRLRVTSEDKEPKEQLQKAIRDRDEAIAKKNAVELELAKCRMDMMSLNSQLLDAIQQKLNLSQQLEAWQDDMHR
  VIDRQLMDTHLKERSQPAAALCRGHSAGRGDEPSIAEGKRLFSFFRKI

• Structural information:
  • Interpro: IPR006933  
  • STRING: ENSP00000380690
• Other Databases: GeneCards:  BICDL1  Malacards:  BICDL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0017137	Rab GTPase binding	IBA	molecular function
GO:0047496	vesicle transport along microtubule	IBA	biological process
GO:0055107	Golgi to secretory granule transport	IBA	biological process
GO:0055107	Golgi to secretory granule transport	ISS	biological process
GO:0031175	neuron projection development	ISS	biological process
GO:0017137	Rab GTPase binding	ISS	molecular function
GO:0005813	centrosome	ISS	cellular component
GO:0034452	dynactin binding	ISS	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0055107	Golgi to secretory granule transport	IEA	biological process
GO:0031175	neuron projection development	IEA	biological process
GO:0017137	Rab GTPase binding	IEA	molecular function
GO:0005813	centrosome	IEA	cellular component
GO:0034452	dynactin binding	IEA	molecular function
GO:0005815	microtubule organizing center	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray