• Gene id: 9255

Gene Summary

• Gene Symbol: AIMP1   Gene   UCSC   Ensembl
• Aliases: EMAP2, EMAPII, HLD3, SCYE1, p43
• Gene name: aminoacyl tRNA synthetase complex interacting multifunctional protein 1
• Alternate names: aminoacyl tRNA synthase complex-interacting multifunctional protein 1, ARS-interacting multifunctional protein 1, endothelial monocyte-activating polypeptide 2, endothelial-monocyte activating polypeptide II, multisynthase complex auxiliary component p43, mult,
• Gene location: 4q24 (106315609: 106349455)     Exons: 10     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a cytokine that is specifically induced by apoptosis, and it is involved in the control of angiogenesis, inflammation, and wound healing. The release of this cytokine renders the tumor-associated vasculature sensitive t
• OMIM: 603605

Protein Summary

• Protein general information: Q12904  
  • Name: Aminoacyl tRNA synthase complex interacting multifunctional protein 1 (Multisynthase complex auxiliary component p43) [Cleaved into: Endothelial monocyte activating polypeptide 2 (EMAP 2) (Endothelial monocyte activating polypeptide II) (EMAP II) (Small i
  • Length: 312  
  • Mass: 34353
• Sequence:

  MANNDAVLKRLEQKGAEADQIIEYLKQQVSLLKEKAILQATLREEKKLRVENAKLKKEIEELKQELIQAEIQNGV
  KQIPFPSGTPLHANSMVSENVIQSTAVTTVSSGTKEQIKGGTGDEKKAKEKIEKKGEKKEKKQQSIAGSADSKPI
  DVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQA
  MVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGV
  CRAQTMSNSGIK

• Structural information:
  • Protein Domains: (151..25-)
    (/note="tRNA-binding-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00209"-)
  • Interpro: IPR012340  IPR002547  
  • Prosite: PS50886
  • PDB: 1E7Z 1EUJ 1FL0 4R3Z
  • PDBsum: 1E7Z 1EUJ 1FL0 4R3Z
  • STRING: ENSP00000378191
• Other Databases: GeneCards:  AIMP1  Malacards:  AIMP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007267	cell-cell signaling	IDA	biological process
GO:0000049	tRNA binding	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0005125	cytokine activity	ISS	molecular function
GO:0001937	negative regulation of endothelial cell proliferation	IDA	biological process
GO:0017101	aminoacyl-tRNA synthetase multienzyme complex	IDA	cellular component
GO:0050900	leukocyte migration	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0017101	aminoacyl-tRNA synthetase multienzyme complex	IDA	cellular component
GO:0000049	tRNA binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0000049	tRNA binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006418	tRNA aminoacylation for protein translation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048514	blood vessel morphogenesis	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0017101	aminoacyl-tRNA synthetase multienzyme complex	IDA	cellular component
GO:0005615	extracellular space	ISS	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0051020	GTPase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070094	positive regulation of glucagon secretion	ISS	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Hypomyelinating leukodystrophy	KEGG:H00679
Hypomyelinating leukodystrophy	KEGG:H00679
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq