• Gene id: 9252

Gene Summary

• Gene Symbol: RPS6KA5   Gene   UCSC   Ensembl
• Aliases: MSK1, MSPK1, RLPK
• Gene name: ribosomal protein S6 kinase A5
• Alternate names: ribosomal protein S6 kinase alpha-5, 90 kDa ribosomal protein S6 kinase 5, RSK-like protein kinase, RSKL, S6K-alpha-5, nuclear mitogen- and stress-activated protein kinase 1, ribosomal protein S6 kinase, 90kDa, polypeptide 5,
• Gene location: 14q32.11 (91060648: 90847860)     Exons: 21     NC_000014.9
• OMIM: 603825

Protein Summary

• Protein general information: O75582  
  • Name: Ribosomal protein S6 kinase alpha 5 (S6K alpha 5) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 5) (Nuclear mitogen and stress activated protein kinase 1) (RSK like protein kinase) (RSKL)
  • Length: 802  
  • Mass: 89865
  • Tissue specificity: Widely expressed with high levels in heart, brain and placenta. Less abundant in lung, kidney and liver. {ECO
• Sequence:

  MEEEGGSSGGAAGTSADGGDGGEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAYGKVFLVRKISGHDTG
  KLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYAFQTETKLHLILDYINGGELFTHLSQRERFT
  EHEVQIYVGEIVLALEHLHKLGIIYRDIKLENILLDSNGHVVLTDFGLSKEFVADETERAYSFCGTIEYMAPDIV
  RGGDSGHDKAVDWWSLGVLMYELLTGASPFTVDGEKNSQAEISRRILKSEPPYPQEMSALAKDLIQRLLMKDPKK
  RLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYSPAALPQSSEKLFQGY
  SFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFYQHYDLDLKDKPLGEGSFSICRKCVHKKSNQ
  AFAVKIISKRMEANTQKEITALKLCEGHPNIVKLHEVFHDQLHTFLVMELLNGGELFERIKKKKHFSETEASYIM
  RKLVSAVSHMHDVGVVHRDLKPENLLFTDENDNLEIKIIDFGFARLKPPDNQPLKTPCFTLHYAAPELLNQNGYD
  ESCDLWSLGVILYTMLSGQVPFQSHDRSLTCTSAVEIMKKIKKGDFSFEGEAWKNVSQEAKDLIQGLLTVDPNKR
  LKMSGLRYNEWLQDGSQLSSNPLMTPDILGSSGAAVHTCVKATFHAFNKYKREGFCLQNVDKAPLAKRRKMKKTS
  TSTETRSSSSESSHSSSSHSHGKTTPTKTLQPSNPADSNNPETLFQFSDSVA

• Structural information:
  • Protein Domains: (49..31-)
    1 (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159-)
    (319..38-)
    (/note="AGC-kinase-C-terminal)
    (426..68-)
    2 (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR000961  IPR011009  IPR017892  IPR000719  IPR017441   IPR016239  IPR008271  
  • Prosite: PS51285 PS00107 PS50011 PS00108
  • PDB: 1VZO 3KN5 3KN6
  • PDBsum: 1VZO 3KN5 3KN6
  • DIP: 30894
  • STRING: ENSP00000479667
• Other Databases: GeneCards:  RPS6KA5  Malacards:  RPS6KA5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0006468	protein phosphorylation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0043990	histone H2A-S1 phosphorylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0043988	histone H3-S28 phosphorylation	IMP	biological process
GO:0043987	histone H3-S10 phosphorylation	IMP	biological process
GO:0032793	positive regulation of CREB transcription factor activity	TAS	biological process
GO:0001818	negative regulation of cytokine production	TAS	biological process
GO:0006355	regulation of transcription, DNA-templated	IMP	biological process
GO:0005634	nucleus	IMP	cellular component
GO:0004674	protein serine/threonine kinase activity	IMP	molecular function
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006954	inflammatory response	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0007411	axon guidance	TAS	biological process
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0016572	histone phosphorylation	TAS	biological process
GO:0033129	positive regulation of histone phosphorylation	IMP	biological process
GO:0035066	positive regulation of histone acetylation	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0070498	interleukin-1-mediated signaling pathway	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006355	regulation of transcription, DNA-templated	IDA	biological process
GO:0016572	histone phosphorylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005524	ATP binding	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004672	protein kinase activity	IDA	molecular function
GO:0007173	epidermal growth factor receptor signaling pathway	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04010	MAPK signaling pathway
hsa05206	MicroRNAs in cancer
hsa05131	Shigellosis
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04722	Neurotrophin signaling pathway
hsa04668	TNF signaling pathway
hsa04713	Circadian entrainment
hsa05219	Bladder cancer

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881