• Gene id: 925

Gene Summary

• Gene Symbol: CD8A   Gene   UCSC   Ensembl
• Aliases: CD8, Leu2, MAL, p32
• Gene name: CD8a molecule
• Alternate names: T-cell surface glycoprotein CD8 alpha chain, CD8 antigen, alpha polypeptide (p32), Leu2 T-lymphocyte antigen, OKT8 T-cell antigen, T cell co-receptor, T-cell antigen Leu2, T-lymphocyte differentiation antigen T8/Leu-2, T8 T-cell antigen,
• Gene location: 2p11.2 (86808395: 86784604)     Exons: 10     NC_000002.12
• Gene summary(Entrez): The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize an
• OMIM: 186910

Protein Summary

• Protein general information: P01732  
  • Name: T cell surface glycoprotein CD8 alpha chain (T lymphocyte differentiation antigen T8/Leu 2) (CD antigen CD8a)
  • Length: 235  
  • Mass: 25,729
• Sequence:

  MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQ
  NKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAP
  TIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSG
  DKPSLSARYV

• Structural information:
  • Protein Domains: Ig-like (22-135)
  • Interpro: IPR015468  IPR007110  IPR036179  IPR013783  IPR003599   IPR013106  
  • Prosite: PS50835
  • PDB: 1AKJ 1CD8 1Q69 2HP4 3QZW
  • PDBsum: 1AKJ 1CD8 1Q69 2HP4 3QZW
  • STRING: ENSP00000283635
• Other Databases: GeneCards:  CD8A  Malacards:  CD8A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002456	T cell mediated immunity	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0006955	immune response	NAS	biological process
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	NAS	biological process
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0015026	coreceptor activity	NAS	molecular function
GO:0019882	antigen processing and presentation	NAS	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0042101	T cell receptor complex	NAS	cellular component
GO:0042110	T cell activation	NAS	biological process
GO:0042288	MHC class I protein binding	NAS	molecular function
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0045065	cytotoxic T cell differentiation	IBA	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0050850	positive regulation of calcium-mediated signaling	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0002456	T cell mediated immunity	IEA	biological process
GO:0002456	T cell mediated immunity	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0006955	immune response	NAS	biological process
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	NAS	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0015026	coreceptor activity	NAS	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019882	antigen processing and presentation	NAS	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0042101	T cell receptor complex	NAS	cellular component
GO:0042110	T cell activation	IEA	biological process
GO:0042110	T cell activation	NAS	biological process
GO:0042288	MHC class I protein binding	NAS	molecular function
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0045065	cytotoxic T cell differentiation	IEA	biological process
GO:0045065	cytotoxic T cell differentiation	IBA	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0050850	positive regulation of calcium-mediated signaling	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0002456	T cell mediated immunity	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0006955	immune response	NAS	biological process
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	NAS	biological process
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0015026	coreceptor activity	NAS	molecular function
GO:0019882	antigen processing and presentation	NAS	biological process
GO:0042101	T cell receptor complex	NAS	cellular component
GO:0042110	T cell activation	NAS	biological process
GO:0042288	MHC class I protein binding	NAS	molecular function
GO:0045065	cytotoxic T cell differentiation	IBA	biological process
GO:0050776	regulation of immune response	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules
hsa04640	Hematopoietic cell lineage
hsa04612	Antigen processing and presentation
hsa04660	T cell receptor signaling pathway
hsa05340	Primary immunodeficiency

Diseases

Associated diseases	References
CD8 deficiency, familial	OMIM: 186910
Combined immunodeficiencies	KEGG: H00093
Attention deficit disorder conduct disorder oppositional defiant disorder	GAD: 11140838
Attention deficit disorder conduct disorder oppositional defiant disorder	GAD: 11140838
Female infertility	INFBASE: 25576428
Recurrent pregnancy loss (RPL)	INFBASE: 10469717
Sterility	MIK: 2853120
Male factor infertility	MIK: 2853120
Defective endometrial receptivity	INFBASE: 25935494
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male infertility	MIK: 2853120
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
2853120	Sterility				Male infertility	T8 antigen IL2-R
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq