• Gene id: 9246

Gene Summary

• Gene Symbol: UBE2L6   Gene   UCSC   Ensembl
• Aliases: RIG-B, UBCH8
• Gene name: ubiquitin conjugating enzyme E2 L6
• Alternate names: ubiquitin/ISG15-conjugating enzyme E2 L6, E2 ubiquitin-conjugating enzyme L6, retinoic acid induced gene B protein, ubiquitin carrier protein L6, ubiquitin conjugating enzyme E2L 6, ubiquitin-protein ligase L6,
• Gene location: 11q12.1 (57568329: 57551654)     Exons: 5     NC_000011.10
• Gene summary(Entrez): The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjuga
• OMIM: 603890

Protein Summary

• Protein general information: O14933  
  • Name: Ubiquitin/ISG15 conjugating enzyme E2 L6 (EC 2.3.2.23) (E2 ubiquitin conjugating enzyme L6) (Retinoic acid induced gene B protein) (RIG B) (UbcH8) (Ubiquitin carrier protein L6) (Ubiquitin protein ligase L6)
  • Length: 153  
  • Mass: 17769
  • Tissue specificity: Present in natural killer cells (at protein level). {ECO
• Sequence:

  MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIY
  HPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVD
  RPS

• Structural information:
  • Interpro: IPR000608  IPR023313  IPR016135  
  • Prosite: PS00183 PS50127
  • CDD: cd00195
  • PDB: 1WZV 1WZW 2KJH
  • PDBsum: 1WZV 1WZW 2KJH
  • DIP: 41477
  • STRING: ENSP00000287156
• Other Databases: GeneCards:  UBE2L6  Malacards:  UBE2L6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000151	ubiquitin ligase complex	IBA	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0031625	ubiquitin protein ligase binding	IBA	molecular function
GO:0042296	ISG15 transferase activity	IBA	molecular function
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0032020	ISG15-protein conjugation	IBA	biological process
GO:0061631	ubiquitin conjugating enzyme activity	IBA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function
GO:0006464	cellular protein modification process	TAS	biological process
GO:0061631	ubiquitin conjugating enzyme activity	IEA	molecular function
GO:0043130	ubiquitin binding	EXP	molecular function
GO:0032480	negative regulation of type I interferon production	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019985	translesion synthesis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042296	ISG15 transferase activity	IEA	molecular function
GO:0032020	ISG15-protein conjugation	IEA	biological process
GO:0019941	modification-dependent protein catabolic process	IEA	biological process
GO:0019787	ubiquitin-like protein transferase activity	IEA	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05012	Parkinson disease
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq