• Gene id: 9244

Gene Summary

• Gene Symbol: CRLF1   Gene   UCSC   Ensembl
• Aliases: CISS, CISS1, CLF, CLF-1, NR6, zcytor5
• Gene name: cytokine receptor like factor 1
• Alternate names: cytokine receptor-like factor 1, class I cytokine receptor, cytokine type 1 receptor CRLP-1, cytokine-like factor 1,
• Gene location: 19p13.11 (18606798: 18593236)     Exons: 9     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the cytokine type I receptor family. The protein forms a secreted complex with cardiotrophin-like cytokine factor 1 and acts on cells expressing ciliary neurotrophic factor receptors. The complex can promote survival of neuro
• OMIM: 300196

Protein Summary

• Protein general information: O75462  
  • Name: Cytokine receptor like factor 1 (Cytokine like factor 1) (CLF 1) (ZcytoR5)
  • Length: 422  
  • Mass: 46302
  • Tissue specificity: Highest levels of expression observed in spleen, thymus, lymph node, appendix, bone marrow, stomach, placenta, heart, thyroid and ovary. Strongly expressed also in fetal lung. {ECO
• Sequence:

  MPAGRRGPAAQSARRPPPLLPLLLLLCVLGAPRAGSGAHTAVISPQDPTLLIGSSLLATCSVHGDPPGATAEGLY
  WTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARDGSILAGSCLYVGLPPEKPVNISCWSKNMKD
  LTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVL
  TLDILDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAG
  LKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGACEPRGGEPSSGPVRRELKQFLGWLK
  KHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGTARGPAR

• Structural information:
  • Protein Domains: (38..13-)
    (/note="Ig-like-C2-type)
    (137..23-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (237..34-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"-)
  • Interpro: IPR003961  IPR036116  IPR015152  IPR036179  IPR013783  
  • Prosite: PS50853
  • CDD: cd00063
  • DIP: 61205
  • STRING: ENSP00000376188
• Other Databases: GeneCards:  CRLF1  Malacards:  CRLF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019955	cytokine binding	IPI	molecular function
GO:0004896	cytokine receptor activity	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IBA	biological process
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0019955	cytokine binding	IBA	molecular function
GO:0043235	receptor complex	IBA	cellular component
GO:0097058	CRLF-CLCF1 complex	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0070106	interleukin-27-mediated signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000672	negative regulation of motor neuron apoptotic process	IEA	biological process
GO:0001657	ureteric bud development	IEA	biological process
GO:0005125	cytokine activity	IDA	contributes to
GO:0005127	ciliary neurotrophic factor receptor binding	IDA	contributes to
GO:0005515	protein binding	IPI	molecular function
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0097058	CRLF-CLCF1 complex	IDA	cellular component
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IDA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0019955	cytokine binding	IPI	molecular function
GO:0004896	cytokine receptor activity	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IBA	biological process
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0019955	cytokine binding	IBA	molecular function
GO:0043235	receptor complex	IBA	cellular component
GO:0097058	CRLF-CLCF1 complex	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0070106	interleukin-27-mediated signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000672	negative regulation of motor neuron apoptotic process	IEA	biological process
GO:0001657	ureteric bud development	IEA	biological process
GO:0005125	cytokine activity	IDA	contributes to
GO:0005127	ciliary neurotrophic factor receptor binding	IDA	contributes to
GO:0005515	protein binding	IPI	molecular function
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0097058	CRLF-CLCF1 complex	IDA	cellular component
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IDA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Cold-induced sweating syndrome	KEGG:H00935
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881