• Gene id: 92421

Gene Summary

• Gene Symbol: CHMP4C   Gene   UCSC   Ensembl
• Aliases: SNF7-3, Shax3, VPS32C
• Gene name: charged multivesicular body protein 4C
• Alternate names: charged multivesicular body protein 4c, SNF7 homolog associated with Alix 3, Snf7 homologue associated with Alix 3, chromatin modifying protein 4C, chromatin-modifying protein 4c, hSnf7-3, hVps32-3, vacuolar protein sorting-associated protein 32-3, vps32-3,
• Gene location: 8q21.13 (81732447: 81759514)     Exons: 5     NC_000008.11
• Gene summary(Entrez): CHMP4C belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor p
• OMIM: 605896

Protein Summary

• Protein general information: Q96CF2  
  • Name: Charged multivesicular body protein 4c (Chromatin modifying protein 4c) (CHMP4c) (SNF7 homolog associated with Alix 3) (SNF7 3) (hSnf7 3) (Vacuolar protein sorting associated protein 32 3) (Vps32 3) (hVps32 3)
  • Length: 233  
  • Mass: 26411
  • Tissue specificity: Expressed in heart, spleen and kidney. {ECO
• Sequence:

  MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALKRKKRF
  EKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQDIAQEISEAFS
  QRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASSQRAEEEDDDI
  KQLAAWAT

• Structural information:
  • Interpro: IPR005024  
  • PDB: 3C3R 5MK3 5V3R 5WA1
  • PDBsum: 3C3R 5MK3 5V3R 5WA1
  • DIP: 38342
  • STRING: ENSP00000297265
• Other Databases: GeneCards:  CHMP4C  Malacards:  CHMP4C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050792	regulation of viral process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902188	positive regulation of viral release from host cell	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0090611	ubiquitin-independent protein catabolic process via the multivesicular body sorting pathway	IMP	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0007080	mitotic metaphase plate congression	IMP	biological process
GO:0061952	midbody abscission	IMP	biological process
GO:0010824	regulation of centrosome duplication	IMP	biological process
GO:0006997	nucleus organization	IMP	biological process
GO:1901673	regulation of mitotic spindle assembly	IMP	biological process
GO:0036258	multivesicular body assembly	TAS	biological process
GO:0000815	ESCRT III complex	TAS	cellular component
GO:0016236	macroautophagy	TAS	biological process
GO:0039702	viral budding via host ESCRT complex	TAS	biological process
GO:0007034	vacuolar transport	IEA	biological process
GO:0009898	cytoplasmic side of plasma membrane	IBA	cellular component
GO:0005771	multivesicular body	IBA	cellular component
GO:0032511	late endosome to vacuole transport via multivesicular body sorting pathway	IBA	biological process
GO:0006900	vesicle budding from membrane	IBA	biological process
GO:0000815	ESCRT III complex	IBA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0030496	midbody	IDA	cellular component
GO:0016197	endosomal transport	TAS	biological process
GO:0019058	viral life cycle	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090543	Flemming body	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0090543	Flemming body	IDA	cellular component
GO:0044878	mitotic cytokinesis checkpoint	IMP	biological process
GO:0044878	mitotic cytokinesis checkpoint	IMP	biological process
GO:0009838	abscission	IMP	biological process
GO:0009838	abscission	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0032466	negative regulation of cytokinesis	IMP	biological process
GO:0032466	negative regulation of cytokinesis	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04217	Necroptosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R