• Gene id: 924

Gene Summary

• Gene Symbol: CD7   Gene   UCSC   Ensembl
• Aliases: GP40, LEU-9, TP41, Tp40
• Gene name: CD7 molecule
• Alternate names: T-cell antigen CD7, CD7 antigen (p41), T-cell leukemia antigen, T-cell surface antigen Leu-9, p41 protein,
• Gene location: 17q25.3 (82320828: 82314864)     Exons: 4     NC_000017.11
• Gene summary(Entrez): This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lym
• OMIM: 610930

Protein Summary

• Protein general information: P09564  
  • Name: T cell antigen CD7 (GP40) (T cell leukemia antigen) (T cell surface antigen Leu 9) (TP41) (CD antigen CD7)
  • Length: 240  
  • Mass: 25409
• Sequence:

  MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDG
  VVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRAS
  ALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDM
  SHSRCNTLSSPNQYQ

• Structural information:
  • Protein Domains: (26..13-)
    (/note="Ig-like"-)
  • Interpro: IPR039090  IPR007110  IPR036179  IPR013783  IPR003599   IPR013106  
  • Prosite: PS50835
  • STRING: ENSP00000312027
• Other Databases: GeneCards:  CD7  Malacards:  CD7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0002250	adaptive immune response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0042110	T cell activation	TAS	biological process
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0016021	integral component of membrane	TAS	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	NAS	biological process
GO:0006955	immune response	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04640	Hematopoietic cell lineage

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq