• Gene id: 9238

Gene Summary

• Gene Symbol: TBRG4   Gene   UCSC   Ensembl
• Aliases: CPR2, FASTKD4
• Gene name: transforming growth factor beta regulator 4
• Alternate names: FAST kinase domain-containing protein 4, FAST kinase domains 4, H_TD2522F11.8, cell cycle progression protein 2, cell cycle progression restoration protein 2, protein TBRG4,
• Gene location: 7p13 (45111746: 45100099)     Exons: 11     NC_000007.14
• OMIM: 110750

Protein Summary

• Protein general information: Q969Z0  
  • Name: FAST kinase domain containing protein 4 (Cell cycle progression restoration protein 2) (Cell cycle progression protein 2) (Protein TBRG4) (Transforming growth factor beta regulator 4)
  • Length: 631  
  • Mass: 70738
  • Tissue specificity: Ubiquitously expressed (PubMed
• Sequence:

  MAAHLVKRCTCLLREAARQAPAMAPVGRLRLAWVAHKTLTSSATSPISHLPGSLMEPVEKERASTPYIEKQVDHL
  IKKATRPEELLELLGGSHDLDSNQAAMVLIRLSHLLSEKPEDKGLLIQDAHFHQLLCLLNSQIASVWHGTLSKLL
  GSLYALGIPKASKELQSVEQEVRWRMRKLKYKHLAFLAESCATLSQEQHSQELLAELLTHLERRWTEIEDSHTLV
  TVMMKVGHLSEPLMNRLEDKCLELVEHFGPNELRKVLVMLAAQSRRSVPLLRAISYHLVQKPFSLTKDVLLDVAY
  AYGKLSFHQTQVSQRLATDLLSLMPSLTSGEVAHCAKSFALLKWLSLPLFEAFAQHVLNRAQDITLPHLCSVLLA
  FARLNFHPDQEDQFFSLVHEKLGSELPGLEPALQVDLVWALCVLQQAREAELQAVLHPEFHIQFLGGKSQKDQNT
  FQKLLHINATALLEYPEYSGPLLPASAVAPGPSALDRKVTPLQKELQETLKGLLGSADKGSLEVATQYGWVLDAE
  VLLDSDGEFLPVRDFVAPHLAQPTGSQSPPPGSKRLAFLRWEFPNFNSRSKDLLGRFVLARRHIVAAGFLIVDVP
  FYEWLELKSEWQKGAYLKDKMRKAVAEELAK

• Structural information:
  • Protein Domains: (561..61-)
    (/note="RAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00619"-)
  • Interpro: IPR013579  IPR010622  IPR013584  
  • Prosite: PS51286
  • STRING: ENSP00000258770
• Other Databases: GeneCards:  TBRG4  Malacards:  TBRG4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005759	mitochondrial matrix	IDA	cellular component
GO:0016071	mRNA metabolic process	IMP	biological process
GO:0044528	regulation of mitochondrial mRNA stability	IMP	biological process
GO:0090615	mitochondrial mRNA processing	IMP	biological process
GO:0044528	regulation of mitochondrial mRNA stability	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0007050	cell cycle arrest	TAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881