• Gene id: 92359

Gene Summary

• Gene Symbol: CRB3   Gene   UCSC   Ensembl
• Gene name: crumbs cell polarity complex component 3
• Alternate names: protein crumbs homolog 3, crumbs 3, cell polarity complex component, crumbs family member 3,
• Gene location: 19p13.3 (6463776: 6467220)     Exons: 5     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the Crumbs family of proteins. This gene is widely expressed in epithelial tissues where the encoded protein isoforms play various roles such as the control of cytokinesis and ciliogenesis or the formation of tight junctions.

Protein Summary

• Protein general information: Q9BUF7  
  • Name: Protein crumbs homolog 3
  • Length: 120  
  • Mass: 12854
  • Tissue specificity: Preferentially expressed in epithelial tissues. Expressed at high levels in lung, kidney, retina, colon and mammary glands. Expressed at moderate levels in liver, spleen, pancreas, placenta and prostate. {ECO
• Sequence:

  MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAALLLAVG
  LALLVRKLREKRQTEGTYRPSSEEQVGARVPPTPNLKLPPEERLI

• Structural information:
  • PDB: 5I7Z
  • PDBsum: 5I7Z
  • STRING: ENSP00000349204
• Other Databases: GeneCards:  CRB3  Malacards:  CRB3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0070830	bicellular tight junction assembly	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0032991	protein-containing complex	IEA	cellular component
GO:0045177	apical part of cell	IEA	cellular component
GO:0017124	SH3 domain binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0072659	protein localization to plasma membrane	IDA	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05165	Human papillomavirus infection
hsa04530	Tight junction

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray