• Gene id: 9235

Gene Summary

• Gene Symbol: IL32   Gene   UCSC   Ensembl
• Aliases: IL-32alpha, IL-32beta, IL-32delta, IL-32gamma, NK4, TAIF, TAIFa, TAIFb, TAIFc, TAIFd
• Gene name: interleukin 32
• Alternate names: interleukin-32, interleukin-32 eta, interleukin-32 small, interleukin-32 theta, natural killer cell transcript 4, natural killer cells protein 4, tumor necrosis factor alpha-inducing factor,
• Gene location: 16p13.3 (3065402: 3069529)     Exons: 6     NC_000016.10
• Gene summary(Entrez): This gene encodes a member of the cytokine family. The protein contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Expression of this protein is increased af

Protein Summary

• Protein general information: P24001  
  • Name: Interleukin 32 (IL 32) (Natural killer cells protein 4) (Tumor necrosis factor alpha inducing factor)
  • Length: 234  
  • Mass: 26676
  • Tissue specificity: Selectively expressed in lymphocytes. Expression is more prominent in immune cells than in non-immune cells. {ECO
• Sequence:

  MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLCLSSQHQAIERFYDKM
  QNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESF
  CDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQ
  KCSEPQSSK

• Structural information:
  • Interpro: IPR028067  
  • DIP: 61119
• Other Databases: GeneCards:  IL32  Malacards:  IL32

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006955	immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0006955	immune response	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0006952	defense response	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R