• Gene id: 92345

Gene Summary

• Gene Symbol: NAF1   Gene   UCSC   Ensembl
• Gene name: nuclear assembly factor 1 ribonucleoprotein
• Alternate names: H/ACA ribonucleoprotein complex non-core subunit NAF1, nuclear assembly factor 1 homolog,
• Gene location: 4q32.2 (163166909: 163109132)     Exons: 13     NC_000004.12
• OMIM: 153432

Protein Summary

• Protein general information: Q96HR8  
  • Name: H/ACA ribonucleoprotein complex non core subunit NAF1 (hNAF1)
  • Length: 494  
  • Mass: 53717
• Sequence:

  MEVVEAAAAQLETLKFNGTDFGVGEGPAAPSPGSAPVPGTQPPLQSFEGSPDAGQTVEVKPAGEQPLQPVLNAVA
  AGTPAPQPQPPAESPACGDCVTSPGAAEPARAPDSLETSDSDSDSDSETDSDSSSSSSSSSSSSSSSSSSCISLP
  PVLSDGDDDLQIEKENKNFPLKTKDELLLNELPSVEELTIILPEDIELKPLGMVSSIIEQLVIIESMTNLPPVNE
  ETVIFKSDRQAAGKIFEIFGPVAHPFYVLRFNSSDHIESKGIKIKETMYFAPSMKDFTQYIFTEKLKQDKGSDAS
  WKNDQEPPPEALDFSDDEKEKEAKQRKKSQIQGRKKLKSEFNEPGEDFTEVHQNWNAHSSASEHAKGYRNREFTR
  GFSRARYPRSCHGRPPPQHFYNSEHMVSQETSGFPSQRQNNPIMPQYPFPLPVFDMHNFPLRPPPPPPPPPVNMG
  WATPNMAAHPLLNLPYSLPPPPPPPPLPPPPSSGDSNSHFGPYY

• Structural information:
  • Interpro: IPR038664  IPR007504  IPR040309  IPR009000  
  • PDB: 2EQN
  • PDBsum: 2EQN
  • STRING: ENSP00000274054
• Other Databases: GeneCards:  NAF1  Malacards:  NAF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000493	box H/ACA snoRNP assembly	IBA	biological process
GO:0042254	ribosome biogenesis	IBA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005732	small nucleolar ribonucleoprotein complex	IBA	cellular component
GO:0000493	box H/ACA snoRNP assembly	IEA	biological process
GO:0001522	pseudouridine synthesis	IEA	biological process
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005732	small nucleolar ribonucleoprotein complex	IEA	cellular component
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006364	rRNA processing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1905323	telomerase holoenzyme complex assembly	IMP	biological process
GO:0043489	RNA stabilization	ISS	biological process
GO:0043489	RNA stabilization	ISS	biological process
GO:0051973	positive regulation of telomerase activity	IMP	biological process
GO:0000493	box H/ACA snoRNP assembly	TAS	biological process
GO:0090669	telomerase RNA stabilization	IMP	biological process
GO:1904874	positive regulation of telomerase RNA localization to Cajal body	HMP	biological process
GO:0070034	telomerase RNA binding	IPI	molecular function
GO:0070034	telomerase RNA binding	IPI	molecular function
GO:1904358	positive regulation of telomere maintenance via telomere lengthening	IMP	biological process
GO:0000454	snoRNA guided rRNA pseudouridine synthesis	ISS	biological process
GO:0032212	positive regulation of telomere maintenance via telomerase	TAS	biological process
GO:0003723	RNA binding	IPI	molecular function
GO:0003723	RNA binding	IPI	molecular function
GO:0000493	box H/ACA snoRNP assembly	ISS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005732	small nucleolar ribonucleoprotein complex	IDA	cellular component
GO:0005732	small nucleolar ribonucleoprotein complex	IDA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0042254	ribosome biogenesis	IDA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881