• Gene id: 92335

Gene Summary

• Gene Symbol: STRADA   Gene   UCSC   Ensembl
• Aliases: LYK5, NY-BR-96, PMSE, STRAD, STRAD alpha, Stlk
• Gene name: STE20 related adaptor alpha
• Alternate names: STE20-related kinase adapter protein alpha, STE20-like pseudokinase, STE20-related kinase adaptor alpha, protein kinase LYK5, serologically defined breast cancer antigen NY-BR-96,
• Gene location: 17q23.3 (63741985: 63702831)     Exons: 14     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene contains a STE20-like kinase domain, but lacks several residues that are critical for catalytic activity, so it is termed a 'pseudokinase'. The protein forms a heterotrimeric complex with serine/threonine kinase 11 (STK11,
• OMIM: 608626

Protein Summary

• Protein general information: Q7RTN6  
  • Name: STE20 related kinase adapter protein alpha (STRAD alpha) (STE20 related adapter protein) (Serologically defined breast cancer antigen NY BR 96)
  • Length: 431  
  • Mass: 48369
• Sequence:

  MSFLVSKPERIRRWVSEKFIVEGLRDLELFGEQPPGDTRRKTNDASSESIASFSKQEVMSSFLPEGGCYELLTVI
  GKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFM
  AYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQ
  RQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDMPATQMLLEKLNGTVPCLL
  DTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARPSASTLLN
  HSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGLVTNLEELEVDDWEF

• Structural information:
  • Protein Domains: (69..37-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  
  • Prosite: PS50011
  • PDB: 1UPK 2WTK 3GNI
  • PDBsum: 1UPK 2WTK 3GNI
  • DIP: 35775
  • STRING: ENSP00000336655
• Other Databases: GeneCards:  STRADA  Malacards:  STRADA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031098	stress-activated protein kinase signaling cascade	IBA	biological process
GO:0023014	signal transduction by protein phosphorylation	IBA	biological process
GO:0032147	activation of protein kinase activity	IBA	biological process
GO:0007346	regulation of mitotic cell cycle	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0030295	protein kinase activator activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007050	cell cycle arrest	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0043539	protein serine/threonine kinase activator activity	IDA	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0071902	positive regulation of protein serine/threonine kinase activity	IEA	biological process
GO:0006468	protein phosphorylation	IDA	NOT|biological process
GO:0005634	nucleus	IDA	cellular component
GO:0004672	protein kinase activity	IDA	NOT|molecular function
GO:0032147	activation of protein kinase activity	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0006611	protein export from nucleus	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04150	mTOR signaling pathway
hsa04152	AMPK signaling pathway

Diseases

Associated diseases	References
Polyhydramnios, megalencephaly, and symptomatic epilepsy	KEGG:H01112
Polyhydramnios, megalencephaly, and symptomatic epilepsy	KEGG:H01112
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R