• Gene id: 92312

Gene Summary

• Gene Symbol: MEX3A   Gene   UCSC   Ensembl
• Aliases: MEX-3A, RKHD4, RNF162
• Gene name: mex-3 RNA binding family member A
• Alternate names: RNA-binding protein MEX3A, RING finger and KH domain-containing protein 4, ring finger and KH domain containing 4, ring finger and KH domain containing protein,
• Gene location: 1q22 (156082464: 156072012)     Exons: 2     NC_000001.11

Protein Summary

• Protein general information: A1L020  
  • Name: RNA binding protein MEX3A (RING finger and KH domain containing protein 4)
  • Length: 520  
  • Mass: 54173
  • Tissue specificity: Highest levels found in fetal brain and testis. Detected also in thymus, salivary gland and uterus. {ECO
• Sequence:

  MPSLVVSGIMERNGGFGELGCFGGSAKDRGLLEDERALQLALDQLCLLGLGEPPAPTAGEDGGGGGGGAPAQPAA
  PPQPAPPPPPAAPPAAPTAAPAAQTPQPPTAPKGASDAKLCALYKEAELRLKGSSNTTECVPVPTSEHVAEIVGR
  QGCKIKALRAKTNTYIKTPVRGEEPVFMVTGRREDVATARREIISAAEHFSMIRASRNKSGAAFGVAPALPGQVT
  IRVRVPYRVVGLVVGPKGATIKRIQQQTNTYIITPSRDRDPVFEITGAPGNVERAREEIETHIAVRTGKILEYNN
  ENDFLAGSPDAAIDSRYSDAWRVHQPGCKPLSTFRQNSLGCIGECGVDSGFEAPRLGEQGGDFGYGGYLFPGYGV
  GKQDVYYGVAETSPPLWAGQENATPTSVLFSSASSSSSSSAKARAGPPGAHRSPATSAGPELAGLPRRPPGEPLQ
  GFSKLGGGGLRSPGGGRDCMVCFESEVTAALVPCGHNLFCMECAVRICERTDPECPVCHITATQAIRIFS

• Structural information:
  • Protein Domains: (132..19-)
    (/note="KH-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117-)
    (223..28-)
    (/note="KH-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117"-)
  • Interpro: IPR004087  IPR004088  IPR036612  IPR001841  IPR013083  
  • Prosite: PS50084 PS50089
  • STRING: ENSP00000432845
• Other Databases: GeneCards:  MEX3A  Malacards:  MEX3A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0000932	P-body	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq