• Gene id: 92304

Gene Summary

• Gene Symbol: SCGB3A1   Gene   UCSC   Ensembl
• Aliases: HIN-1, HIN1, LU105, PnSP-2, UGRP2
• Gene name: secretoglobin family 3A member 1
• Alternate names: secretoglobin family 3A member 1, cytokine HIN-1, cytokine high in normal-1, high in normal 1, pneumo secretory protein 2, uteroglobin-related protein 2,
• Gene location: 5q35.3 (180591498: 180590104)     Exons: 3     NC_000005.10
• OMIM: 606500

Protein Summary

• Protein general information: Q96QR1  
  • Name: Secretoglobin family 3A member 1 (Cytokine HIN 1) (High in normal 1) (Pneumo secretory protein 2) (PnSP 2) (Uteroglobin related protein 2)
  • Length: 104  
  • Mass: 10100
  • Tissue specificity: Highly expressed in lung and prostate (PubMed
• Sequence:

  MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLLLSSLGIPVNHLIEGS
  QKCVAELGPQAVGAVKALKALLGALTVFG

• Structural information:
  • Interpro: IPR040301  
  • STRING: ENSP00000292641
• Other Databases: GeneCards:  SCGB3A1  Malacards:  SCGB3A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901741	positive regulation of myoblast fusion	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1901741	positive regulation of myoblast fusion	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0030308	negative regulation of cell growth	NAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0042127	regulation of cell population proliferation	NAS	biological process
GO:0005125	cytokine activity	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881