• Gene id: 9230

Gene Summary

• Gene Symbol: RAB11B   Gene   UCSC   Ensembl
• Aliases: H-YPT3, NDAGSCW
• Gene name: RAB11B, member RAS oncogene family
• Alternate names: ras-related protein Rab-11B, GTP-binding protein YPT3, RAB11B, member of RAS oncogene family,
• Gene location: 19p13.2 (8390359: 8404433)     Exons: 8     NC_000019.10
• Gene summary(Entrez): The Ras superfamily of small GTP-binding proteins, which includes the Ras (see MIM 190020), Ral (see MIM 179550), Rho (see MIM 165390), Rap (see MIM 179520), and Rab (see MIM 179508) families, is involved in controlling a diverse set of essential cellular
• OMIM: 604198

Protein Summary

• Protein general information: Q15907  
  • Name: Ras related protein Rab 11B (GTP binding protein YPT3)
  • Length: 218  
  • Mass: 24489
• Sequence:

  MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRA
  ITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNNLSF
  IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISVPPTTDGQKPNKLQCCQNL

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  
  • Prosite: PS51419
  • PDB: 2F9L 2F9M 4OJK
  • PDBsum: 2F9L 2F9M 4OJK
  • DIP: 50898
  • STRING: ENSP00000333547
• Other Databases: GeneCards:  RAB11B  Malacards:  RAB11B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0150093	amyloid-beta clearance by transcytosis	IGI	biological process
GO:0003924	GTPase activity	IBA	molecular function
GO:0005768	endosome	IBA	cellular component
GO:0012505	endomembrane system	IBA	cellular component
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0045055	regulated exocytosis	IBA	biological process
GO:0055037	recycling endosome	IBA	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:0006887	exocytosis	IBA	biological process
GO:0045054	constitutive secretory pathway	IBA	biological process
GO:0019003	GDP binding	IDA	molecular function
GO:0005525	GTP binding	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0071468	cellular response to acidic pH	IDA	biological process
GO:0045335	phagocytic vesicle	IDA	cellular component
GO:2000008	regulation of protein localization to cell surface	IMP	biological process
GO:1990126	retrograde transport, endosome to plasma membrane	IMP	biological process
GO:0055037	recycling endosome	ISS	cellular component
GO:0045055	regulated exocytosis	ISS	biological process
GO:0044070	regulation of anion transport	IMP	biological process
GO:0035773	insulin secretion involved in cellular response to glucose stimulus	ISS	biological process
GO:0033572	transferrin transport	ISS	biological process
GO:0032402	melanosome transport	ISS	biological process
GO:0008021	synaptic vesicle	ISS	cellular component
GO:0001881	receptor recycling	ISS	biological process
GO:2001135	regulation of endocytic recycling	ISS	biological process
GO:0045054	constitutive secretory pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0055038	recycling endosome membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098993	anchored component of synaptic vesicle membrane	IEA	cellular component
GO:0045055	regulated exocytosis	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0055037	recycling endosome	IEA	cellular component
GO:0045055	regulated exocytosis	IEA	biological process
GO:0035773	insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:0033572	transferrin transport	IEA	biological process
GO:0032402	melanosome transport	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0001881	receptor recycling	IEA	biological process
GO:0045054	constitutive secretory pathway	IEA	biological process
GO:2001135	regulation of endocytic recycling	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0031489	myosin V binding	IPI	molecular function
GO:0090150	establishment of protein localization to membrane	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa05164	Influenza A
hsa04152	AMPK signaling pathway
hsa04962	Vasopressin-regulated water reabsorption

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq