• Gene id: 923

Gene Summary

• Gene Symbol: CD6   Gene   UCSC   Ensembl
• Aliases: TP120
• Gene name: CD6 molecule
• Alternate names: T-cell differentiation antigen CD6, CD6 antigen, T12,
• Gene location: 11q12.2 (60971677: 61020376)     Exons: 13     NC_000011.10
• Gene summary(Entrez): This gene encodes a protein found on the outer membrane of T-lymphocytes as well as some other immune cells. The encoded protein contains three scavenger receptor cysteine-rich (SRCR) domains and a binding site for an activated leukocyte cell adhesion mol
• OMIM: 610462

Protein Summary

• Protein general information: P30203  
  • Name: T cell differentiation antigen CD6 (T12) (TP120) (CD antigen CD6) [Cleaved into: Soluble CD6]
  • Length: 668  
  • Mass: 71801
  • Tissue specificity: Detected on thymocytes (PubMed
• Sequence:

  MWLFFGITGLLTAALSGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEVRLEASWEPACGALWD
  SRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCEVVEHACRSDGRR
  ARVTCAENRALRLVDGGGACAGRVEMLEHGEWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLHFTPGRGPIHR
  DQVNCSGAEAYLWDCPGLPGQHYCGHKEDAGAVCSEHQSWRLTGGADRCEGQVEVHFRGVWNTVCDSEWYPSEAK
  VLCQSLGCGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLCSASRSLHNLSTPEVP
  ASVQTVTIESSVTVKIENKESRELMLLIPSIVLGILLLGSLIFIAFILLRIKGKYALPVMVNHQHLPTTIPAGSN
  SYQPVPITIPKEVFMLPIQVQAPPPEDSDSGSDSDYEHYDFSAQPPVALTTFYNSQRHRVTDEEVQQSRFQMPPL
  EEGLEELHASHIPTANPGHCITDPPSLGPQYHPRSNSESSTSSGEDYCNSPKSKLPPWNPQVFSSERSSFLEQPP
  NLELAGTQPAFSAGPPADDSSSTSSGEWYQNFQPPPQPPSEEQFGCPGSPSPQPDSTDNDDYDDISAA

• Structural information:
  • Protein Domains: (45..15-)
    (/note="SRCR-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00196-)
    (161..26-)
    (/note="SRCR-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00196-)
    (265..36-)
    (/note="SRCR-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00196"-)
  • Interpro: IPR001190  IPR017448  IPR036772  
  • Prosite: PS00420 PS50287
  • PDB: 5A2E
  • PDBsum: 5A2E
  • DIP: 43704
  • STRING: ENSP00000323280
• Other Databases: GeneCards:  CD6  Malacards:  CD6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031012	extracellular matrix	IBA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0001772	immunological synapse	IDA	cellular component
GO:0042101	T cell receptor complex	IDA	colocalizes with
GO:0031226	intrinsic component of plasma membrane	IDA	cellular component
GO:1900017	positive regulation of cytokine production involved in inflammatory response	IDA	biological process
GO:0002438	acute inflammatory response to antigenic stimulus	IDA	biological process
GO:0032496	response to lipopolysaccharide	IDA	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:0001530	lipopolysaccharide binding	IDA	molecular function
GO:0070891	lipoteichoic acid binding	IMP	molecular function
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IMP	biological process
GO:0042102	positive regulation of T cell proliferation	IMP	biological process
GO:0001771	immunological synapse formation	IMP	biological process
GO:0005044	scavenger receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray