About Us

Search Result


Gene id 92283
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol ZNF461   Gene   UCSC   Ensembl
Aliases GIOT-1, GIOT1, HZF28
Gene name zinc finger protein 461
Alternate names zinc finger protein 461, gonadotropin-inducible ovary transcription repressor 1, zinc finger protein 28,
Gene location 19q13.12 (36666836: 36636617)     Exons: 9     NC_000019.10
OMIM 608640

Protein Summary

Protein general information Q8TAF7  

Name: Zinc finger protein 461 (Gonadotropin inducible ovary transcription repressor 1) (GIOT 1)

Length: 563  Mass: 66214

Tissue specificity: Widely expressed, with highest levels in liver, kidney, pancreas, thymus, and small intestine. {ECO

Sequence MAHELVMFRDVAIDVSQEEWECLNPAQRNLYKEVMLENYSNLVSLGLSVSKPAVISSLEQGKEPWMVVREETGRW
CPGTWKTWGFHNNFLDNNEATDINADLASRDEPQKLSPKRDIYETELSQWVNMEEFKSHSPERSIFSAIWEGNCH
FEQHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFSYHLFFSHHKRTHSKELSECKECT
EIVNTPCLFKQQTIQNGDKCNECKECWKAFVHCSQLKHLRIHNGEKRYECNECGKAFNYGSELTLHQRIHTGEKP
YECKECGKAFRQRSQLTQHQRLHTGEKPYECKQCGKAFIRGFQLTEHLRLHTGEKPYECKECGKTFRHRSHLTIH
QRIHTGEKPYECRECGKAFSYHSSFSHHQKIHSGKKPYECHECGKAFCDGLQLTLHQRIHTGEKPYECKECGKTF
RQCSHLKRHQRIHTGEKPHECMICGKAFRLHSHLIQHQRIHTGEKPYECKECGKAFSYHSSFSHHQRIHSGKKPY
QCGKAFNHRLQLNLHQTLHTGEKPVRFPLLPPHPSLAS
Structural information
Protein Domains
(6..7-)
(/note="KRAB-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00119"-)
Interpro:  IPR001909  IPR036051  IPR036236  IPR013087  
Prosite:   PS50805 PS00028 PS50157
CDD:   cd07765
STRING:   ENSP00000467931
Other Databases GeneCards:  ZNF461  Malacards:  ZNF461

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0003676 nucleic acid binding
IEA molecular function
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological process
GO:0046872 metal ion binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0003677 DNA binding
IEA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005634 nucleus
IEA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa05168Herpes simplex virus 1 infection
Associated diseases References
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract