• Gene id: 9220

Gene Summary

• Gene Symbol: TIAF1   Gene   UCSC   Ensembl
• Aliases: MAJN, SPR210
• Gene name: TGFB1-induced anti-apoptotic factor 1
• Alternate names: TGFB1-induced anti-apoptotic factor 1, 12 kDa TGF-beta-1-induced antiapoptotic factor, TGF-beta-1-induced antiapoptotic factor 1, molecule associated with Jak-3 N-terminal,
• Gene location: 17q11.2 (16660156: 16630740)     Exons: 8     NC_000019.10
• OMIM: 609517

Protein Summary

• Protein general information: O95411  
  • Name: TGFB1 induced anti apoptotic factor 1 (12 kDa TGF beta 1 induced antiapoptotic factor)
  • Length: 115  
  • Mass: 12414
  • Tissue specificity: Not detectable in normal kidney and liver. Up-regulated in chronic and acute allograft rejection
• Sequence:

  MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCND
  LFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG

• Structural information:
  • STRING: ENSP00000352424
• Other Databases: GeneCards:  TIAF1  Malacards:  TIAF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0005634	nucleus	NAS	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq