• Gene id: 9219

Gene Summary

• Gene Symbol: MTA2   Gene   UCSC   Ensembl
• Aliases: MTA1L1, PID
• Gene name: metastasis associated 1 family member 2
• Alternate names: metastasis-associated protein MTA2, MTA1-L1 protein, metastasis -associated gene 1-like 1, metastasis associated gene family, member 2, metastasis-associated 1-like 1, metastasis-associated protein 2, p53 target protein in deacetylase complex,
• Gene location: 11q12.3 (62601839: 62593202)     Exons: 19     NC_000011.10
• Gene summary(Entrez): This gene encodes a protein that has been identified as a component of NuRD, a nucleosome remodeling deacetylase complex identified in the nucleus of human cells. It shows a very broad expression pattern and is strongly expressed in many tissues. It may r
• OMIM: 603947

Protein Summary

• Protein general information: O94776  
  • Name: Metastasis associated protein MTA2 (Metastasis associated 1 like 1) (MTA1 L1 protein) (p53 target protein in deacetylase complex)
  • Length: 668  
  • Mass: 75,023
• Sequence:

  MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGV
  SEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVG
  CKYQAEIPDRLVEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAA
  SRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSL
  ASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAGFQKGLTCESCHTTQS
  AQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGATRGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKN
  RQTFLLQTTKLTRLARRMCRDLLQPRRAARRPYAPINANAIKAECSIRLPKAAKTPLKIHPLVRLPLATIVKDLV
  AQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPAD
  APNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLIAVRPPVPLPAPSHPASTNEPIVLED

• Structural information:
  • Protein Domains: BAH. (1-144)
    ELM2. (145-256)
    SANT. (263-315)
  • Interpro: IPR001025  IPR000949  IPR009057  IPR035170  IPR037964   IPR001005  IPR017884  IPR000679  
  • Prosite: PS51038 PS51156 PS51293
  • DIP: 46519
  • STRING: ENSP00000278823
• Other Databases: GeneCards:  MTA2  Malacards:  MTA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000118	histone deacetylase complex	TAS	cellular component
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0000989	transcription factor activity, transcription factor binding	IEA	molecular function
GO:0001085	RNA polymerase II transcription factor binding	IPI	molecular function
GO:0001103	RNA polymerase II repressing transcription factor binding	IPI	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IEA	molecular function
GO:0004407	histone deacetylase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005667	transcription factor complex	IDA	cellular component
GO:0006306	DNA methylation	IEA	biological process
GO:0006333	chromatin assembly or disassembly	TAS	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0010762	regulation of fibroblast migration	IEA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016575	histone deacetylation	IEA	biological process
GO:0016581	NuRD complex	IDA	cellular component
GO:0042826	histone deacetylase binding	IEA	molecular function
GO:0043044	ATP-dependent chromatin remodeling	IDA	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0000978	RNA polymerase II core promoter proximal region sequence-specific DNA binding	IDA	molecular function
GO:0000980	RNA polymerase II distal enhancer sequence-specific DNA binding	IDA	molecular function
GO:0031492	nucleosomal DNA binding	IDA	molecular function
GO:0000118	histone deacetylase complex	IEA	cellular component
GO:0000118	histone deacetylase complex	TAS	cellular component
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0000989	transcription factor activity, transcription factor binding	IEA	molecular function
GO:0001085	RNA polymerase II transcription factor binding	IPI	molecular function
GO:0001103	RNA polymerase II repressing transcription factor binding	IPI	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IEA	molecular function
GO:0004407	histone deacetylase activity	IEA	molecular function
GO:0004407	histone deacetylase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005667	transcription factor complex	IDA	cellular component
GO:0006306	DNA methylation	IEA	biological process
GO:0006333	chromatin assembly or disassembly	TAS	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0010762	regulation of fibroblast migration	IEA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016575	histone deacetylation	IEA	biological process
GO:0016581	NuRD complex	IEA	cellular component
GO:0016581	NuRD complex	IDA	cellular component
GO:0042826	histone deacetylase binding	IEA	molecular function
GO:0043044	ATP-dependent chromatin remodeling	IDA	biological process
GO:0043234	protein complex	IDA	cellular component
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0044212	transcription regulatory region DNA binding	IEA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0000978	RNA polymerase II core promoter proximal region sequence-specific DNA binding	IDA	molecular function
GO:0000980	RNA polymerase II distal enhancer sequence-specific DNA binding	IDA	molecular function
GO:0031492	nucleosomal DNA binding	IDA	molecular function
GO:0000118	histone deacetylase complex	TAS	cellular component
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0001085	RNA polymerase II transcription factor binding	IPI	molecular function
GO:0001103	RNA polymerase II repressing transcription factor binding	IPI	molecular function
GO:0004407	histone deacetylase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005667	transcription factor complex	IDA	cellular component
GO:0006333	chromatin assembly or disassembly	TAS	biological process
GO:0016020	membrane	IDA	cellular component
GO:0016581	NuRD complex	IDA	cellular component
GO:0043044	ATP-dependent chromatin remodeling	IDA	biological process
GO:0043234	protein complex	IDA	cellular component
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0000978	RNA polymerase II core promoter proximal region sequence-specific DNA binding	IDA	molecular function
GO:0000980	RNA polymerase II distal enhancer sequence-specific DNA binding	IDA	molecular function
GO:0031492	nucleosomal DNA binding	IDA	molecular function

Diseases

Associated diseases	References
Spermatogenesis defects	MIK: 24524831
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male infertility	MIK: 24524831
Spermatogenetic defects	MIK: 24524831
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24524831	Male infertility, Spermatogenetic defects			40 (30 infertile men with normal CFTR and AZF tests and karyotype, 10 fertile male controls)	Male infertility
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray