About Us

Search Result


Gene id 9218
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol VAPA   Gene   UCSC   Ensembl
Aliases VAP-33, VAP-A, VAP33, hVAP-33
Gene name VAMP associated protein A
Alternate names vesicle-associated membrane protein-associated protein A, 33 kDa VAMP-associated protein, VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa, VAMP-A, epididymis secretory sperm binding protein,
Gene location 18p11.22 (9914015: 9960020)     Exons: 9     NC_000018.10
Gene summary(Entrez) The protein encoded by this gene is a type IV membrane protein. It is present in the plasma membrane and intracellular vesicles. It may also be associated with the cytoskeleton. This protein may function in vesicle trafficking, membrane fusion, protein co
OMIM 605703

Protein Summary

Protein general information Q9P0L0  

Name: Vesicle associated membrane protein associated protein A (VAMP A) (VAMP associated protein A) (VAP A) (33 kDa VAMP associated protein) (VAP 33)

Length: 249  Mass: 27893

Tissue specificity: Ubiquitous.

Sequence MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVT
VSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPL
NASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVT
SPLPSLLVVIAAIFIGFFLGKFIL
Structural information
Protein Domains
(14..13-)
(/note="MSP-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00132"-)
Interpro:  IPR013783  IPR000535  IPR008962  IPR016763  IPR030229  
Prosite:   PS50202

PDB:  
2RR3
PDBsum:   2RR3

DIP:  

41135

MINT:  
Other Databases GeneCards:  VAPA  Malacards:  VAPA

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005789 endoplasmic reticulum mem
brane
IBA cellular component
GO:0031175 neuron projection develop
ment
IBA biological process
GO:0033149 FFAT motif binding
IBA molecular function
GO:0005886 plasma membrane
IBA cellular component
GO:0005789 endoplasmic reticulum mem
brane
IDA cellular component
GO:0005783 endoplasmic reticulum
IDA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0031175 neuron projection develop
ment
IMP biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0070972 protein localization to e
ndoplasmic reticulum
IMP biological process
GO:0008219 cell death
IMP biological process
GO:0005515 protein binding
IPI molecular function
GO:0005789 endoplasmic reticulum mem
brane
IEA cellular component
GO:0033149 FFAT motif binding
IEA molecular function
GO:0070972 protein localization to e
ndoplasmic reticulum
IEA biological process
GO:0030054 cell junction
IEA cellular component
GO:0005783 endoplasmic reticulum
IEA cellular component
GO:0005923 bicellular tight junction
IEA cellular component
GO:0016020 membrane
IEA cellular component
GO:0016032 viral process
IEA biological process
GO:0005886 plasma membrane
IEA cellular component
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0061025 membrane fusion
TAS biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0044829 positive regulation by ho
st of viral genome replic
ation
IDA biological process
GO:0044791 positive regulation by ho
st of viral release from
host cell
IDA biological process
GO:0044828 negative regulation by ho
st of viral genome replic
ation
IDA biological process
GO:0005886 plasma membrane
TAS cellular component
GO:0030148 sphingolipid biosynthetic
process
TAS biological process
GO:0035577 azurophil granule membran
e
TAS cellular component
GO:0043312 neutrophil degranulation
TAS biological process
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular component
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005783 endoplasmic reticulum
IEA cellular component
GO:0015630 microtubule cytoskeleton
IEA cellular component
GO:0045296 cadherin binding
HDA molecular function
GO:0005789 endoplasmic reticulum mem
brane
IEA cellular component
GO:0005923 bicellular tight junction
IEA cellular component
GO:0031965 nuclear membrane
IEA cellular component
GO:0005886 plasma membrane
IEA cellular component
GO:0005783 endoplasmic reticulum
IDA cellular component
GO:0000139 Golgi membrane
IEA cellular component
GO:0005783 endoplasmic reticulum
IDA cellular component
GO:0005923 bicellular tight junction
IDA colocalizes with
GO:0070971 endoplasmic reticulum exi
t site
IDA NOT|cellular component
GO:0005886 plasma membrane
IDA cellular component
GO:0048471 perinuclear region of cyt
oplasm
IDA colocalizes with
GO:0031982 vesicle
IDA cellular component
GO:0034975 protein folding in endopl
asmic reticulum
IMP NOT|biological process
GO:0046982 protein heterodimerizatio
n activity
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0008017 microtubule binding
IMP molecular function
GO:0090114 COPII-coated vesicle budd
ing
IMP biological process
GO:0043123 positive regulation of I-
kappaB kinase/NF-kappaB s
ignaling
HMP biological process
GO:0019904 protein domain specific b
inding
IPI molecular function
GO:0006888 endoplasmic reticulum to
Golgi vesicle-mediated tr
ansport
IMP biological process
GO:0007029 endoplasmic reticulum org
anization
IMP NOT|biological process
GO:0046982 protein heterodimerizatio
n activity
IPI molecular function
GO:0033149 FFAT motif binding
IMP molecular function
GO:0005783 endoplasmic reticulum
HDA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04979Cholesterol metabolism
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract