• Gene id: 92170

Gene Summary

• Gene Symbol: MTG1   Gene   UCSC   Ensembl
• Aliases: GTP, GTPBP7
• Gene name: mitochondrial ribosome associated GTPase 1
• Alternate names: mitochondrial ribosome-associated GTPase 1, GTP-binding protein 7 (putative), mitochondrial GTPase 1 homolog,
• Gene location: 10q26.3 (133394156: 133422519)     Exons: 11     NC_000010.11
• OMIM: 607299

Protein Summary

• Protein general information: Q9BT17  
  • Name: Mitochondrial ribosome associated GTPase 1 (GTP binding protein 7) (Mitochondrial GTPase 1)
  • Length: 334  
  • Mass: 37237
• Sequence:

  MRLTPRALCSAAQAAWRENFPLCGRDVARWFPGHMAKGLKKMQSSLKLVDCIIEVHDARIPLSGRNPLFQETLGL
  KPHLLVLNKMDLADLTEQQKIMQHLEGEGLKNVIFTNCVKDENVKQIIPMVTELIGRSHRYHRKENLEYCIMVIG
  VPNVGKSSLINSLRRQHLRKGKATRVGGEPGITRAVMSKIQVSERPLMFLLDTPGVLAPRIESVETGLKLALCGT
  VLDHLVGEETMADYLLYTLNKHQRFGYVQHYGLGSACDNVERVLKSVAVKLGKTQKVKVLTGTGNVNIIQPNYPA
  AARDFLQTFRRGLLGSVMLDLDVLRGHPPAETLP

• Structural information:
  • Protein Domains: (36..20-)
    (/note="CP-type-G)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01058"-)
  • Interpro: IPR030378  IPR023179  IPR019991  IPR006073  IPR016478   IPR027417  
  • Prosite: PS51721
  • STRING: ENSP00000323047
• Other Databases: GeneCards:  MTG1  Malacards:  MTG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0003924	GTPase activity	IBA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0005761	mitochondrial ribosome	IDA	cellular component
GO:0005759	mitochondrial matrix	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0070129	regulation of mitochondrial translation	IMP	biological process
GO:0044065	regulation of respiratory system process	IMP	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0006417	regulation of translation	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq