• Gene id: 92154

Gene Summary

• Gene Symbol: MTSS2   Gene   UCSC   Ensembl
• Aliases: ABBA, ABBA-1, ABBA1, MTSS1L
• Gene name: MTSS I-BAR domain containing 2
• Alternate names: protein MTSS 2, MTSS1-like protein, MTSS1L, I-BAR domain containing, actin-bundling with BAIAP2 homology protein 1, metastasis suppressor 1-like,
• Gene location: 16q22.1 (68035734: 68046858)     Exons: 12     NC_000017.11
• OMIM: 616951

Protein Summary

• Protein general information: Q765P7  
  • Name: Protein MTSS 2 (Actin bundling with BAIAP2 homology protein 1) (ABBA 1) (MTSS1 like protein)
  • Length: 747  
  • Mass: 79929
• Sequence:

  METAEKECGALGGLFQAIVNDMKSSYPIWEDFNSKATKLHSQLRTTVLAAVAFLDAFQKVADMATNTRGATRDIG
  SALTRMCMRHRSIETKLRQFTNALLESLINPLQERIEDWKKAANQLDKDHAKEYKRARHEIKKKSSDTLKLQKKA
  RKELLGKGDLQPQLDSALQDVNDMYLLLEETEKQAVRRALIEERGRFCTFITFLQPVVNGELTMLGEITHLQGII
  DDLVVLTAEPHKLPPASEQVIKDLKGSDYSWSYQTPPSSPSSSSSRKSSMCSAPSSSSSAKGGGAPWPGGAQTYS
  PSSTCRYRSLAQPATTTARLSSVSSHDSGFVSQDATYSKPPSPMPSDITSQKSSSSASSEASETCQSVSECSSPT
  SDWSKVGSHEQPSGATLQRRKDRVELLRDTEPGPASGGTLGPSGEEAPRPRMSPATIAAKHGEEVSPAASDLAMV
  LTRGLSLEHQKSSRDSLQYSSGYSTQTTTPSCSEDTIPSQGSDYDCYSVNGDADSEGPPEFDKSSTIPRNSNIAQ
  NYRRLIQTKRPASTAGLPTAGLPTATGLPSGAPPGVATIRRTPSTKPTVRRALSSAGPIPIRPPIVPVKTPTVPD
  SPGYMGPTRAGSEECVFYTDETASPLAPDLAKASPKRLSLPNTAWGSPSPEAAGYPGAGAEDEQQQLAANRHSLV
  EKLGELVAGAHALGEGQFPFPTALSATPTEETPTPPPAATSDPPAEDMLVAIRRGVRLRRTVTNDRSAPRIL

• Structural information:
  • Protein Domains: (1..25-)
    (/note="IMD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00668-)
    (719..73-)
    (/note="WH2"-)
  • Interpro: IPR027267  IPR013606  IPR030127  IPR030059  
  • Prosite: PS51338
  • STRING: ENSP00000341171
• Other Databases: GeneCards:  MTSS2  Malacards:  MTSS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003779	actin binding	IEA	molecular function
GO:0097178	ruffle assembly	IEA	biological process
GO:0007009	plasma membrane organization	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097581	lamellipodium organization	IEA	biological process
GO:0061024	membrane organization	IEA	biological process
GO:0003785	actin monomer binding	IEA	molecular function
GO:0001726	ruffle	IEA	cellular component
GO:0048365	Rac GTPase binding	IEA	molecular function
GO:0030864	cortical actin cytoskeleton	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IEA	molecular function
GO:0001726	ruffle	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0090630	activation of GTPase activity	IDA	biological process
GO:0036120	cellular response to platelet-derived growth factor stimulus	IDA	biological process
GO:0032587	ruffle membrane	IDA	cellular component
GO:0048365	Rac GTPase binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq