• Gene id: 9214

Gene Summary

• Gene Symbol: FCMR   Gene   UCSC   Ensembl
• Aliases: FAIM3, TOSO
• Gene name: Fc fragment of IgM receptor
• Alternate names: fas apoptotic inhibitory molecule 3, Fc mu receptor, IgM Fc fragment receptor, IgM Fc receptor, immunoglobulin mu Fc receptor, regulator of Fas-induced apoptosis Toso,
• Gene location: 1q32.1 (206922000: 206903281)     Exons: 8     NC_000001.11
• Gene summary(Entrez): Fc receptors specifically bind to the Fc region of immunoglobulins (Igs) to mediate the unique functions of each Ig class. FAIM3 encodes an Fc receptor for IgM (see MIM 147020) (Kubagawa et al., 2009 [PubMed 19858324]; Shima et al., 2010 [PubMed 20042454]
• OMIM: 300798

Protein Summary

• Protein general information: O60667  
  • Name: Fas apoptotic inhibitory molecule 3 (IgM Fc fragment receptor) (Regulator of Fas induced apoptosis Toso)
  • Length: 390  
  • Mass: 43146
  • Tissue specificity: Expressed in lymph nodes, peripheral blood leukocytes, lung, thymus and kidneys. Very weak expression detected in spleen, liver, heart, and salivary gland. Expressed in lymphoid cell lines such as Jurkat, CEM-T4, MOLT-4, HB11;19 and Re
• Sequence:

  MDFWLWPLYFLPVSGALRILPEVKVEGELGGSVTIKCPLPEMHVRIYLCREMAGSGTCGTVVSTTNFIKAEYKGR
  VTLKQYPRKNLFLVEVTQLTESDSGVYACGAGMNTDRGKTQKVTLNVHSEYEPSWEEQPMPETPKWFHLPYLFQM
  PAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTASKISALEGLLKPQTP
  SYNHHTRLHRQRALDYGSQSGREGQGFHILIPTILGLFLLALLGLVVKRAVERRKALSRRARRLAVRMRALESSQ
  RPRGSPRPRSQNNIYSACPRRARGADAAGTGEAPVPGPGAPLPPAPLQVSESPWLHAPSLKTSCEYVSLYHQPAA
  MMEDSDSDDYINVPA

• Structural information:
  • Protein Domains: (33..10-)
    (/note="Ig-like"-)
  • Interpro: IPR036179  IPR013783  IPR003599  IPR013106  
  • STRING: ENSP00000356058
• Other Databases: GeneCards:  FCMR  Malacards:  FCMR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002376	immune system process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006968	cellular defense response	TAS	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006968	cellular defense response	TAS	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881