• Gene id: 9213

Gene Summary

• Gene Symbol: XPR1   Gene   UCSC   Ensembl
• Aliases: IBGC6, SLC53A1, SYG1, X3
• Gene name: xenotropic and polytropic retrovirus receptor 1
• Alternate names: xenotropic and polytropic retrovirus receptor 1, X-receptor, protein SYG1 homolog, solute carrier family 53 (phosphate exporter), member 1, xenotropic and polytropic murine leukemia virus receptor X3,
• Gene location: 1q25.3 (180632021: 180890278)     Exons: 15     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a receptor for the xenotropic and polytropic classes of murine leukemia viruses. The encoded protein is involved in phosphate homeostasis by mediating phosphate export from the cell. Defects in this gene have been assoc
• OMIM: 616772

Protein Summary

• Protein general information: Q9UBH6  
  • Name: Xenotropic and polytropic retrovirus receptor 1 (Protein SYG1 homolog) (Xenotropic and polytropic murine leukemia virus receptor X3) (X receptor)
  • Length: 696  
  • Mass: 81535
  • Tissue specificity: Widely expressed. Detected in spleen, lymph node, thymus, leukocytes, bone marrow, heart, kidney, pancreas and skeletal muscle. {ECO
• Sequence:

  MKFAEHLSAHITPEWRKQYIQYEAFKDMLYSAQDQAPSVEVTDEDTVKRYFAKFEEKFFQTCEKELAKINTFYSE
  KLAEAQRRFATLQNELQSSLDAQKESTGVTTLRQRRKPVFHLSHEERVQHRNIKDLKLAFSEFYLSLILLQNYQN
  LNFTGFRKILKKHDKILETSRGADWRVAHVEVAPFYTCKKINQLISETEAVVTNELEDGDRQKAMKRLRVPPLGA
  AQPAPAWTTFRVGLFCGIFIVLNITLVLAAVFKLETDRSIWPLIRIYRGGFLLIEFLFLLGINTYGWRQAGVNHV
  LIFELNPRSNLSHQHLFEIAGFLGILWCLSLLACFFAPISVIPTYVYPLALYGFMVFFLINPTKTFYYKSRFWLL
  KLLFRVFTAPFHKVGFADFWLADQLNSLSVILMDLEYMICFYSLELKWDESKGLLPNNSEESGICHKYTYGVRAI
  VQCIPAWLRFIQCLRRYRDTKRAFPHLVNAGKYSTTFFMVTFAALYSTHKERGHSDTMVFFYLWIVFYIISSCYT
  LIWDLKMDWGLFDKNAGENTFLREEIVYPQKAYYYCAIIEDVILRFAWTIQISITSTTLLPHSGDIIATVFAPLE
  VFRRFVWNFFRLENEHLNNCGEFRAVRDISVAPLNADDQTLLEQMMDQDDGVRNRQKNRSWKYNQSISLRRPRLA
  SQSKARDTKVLIEDTDDEANT

• Structural information:
  • Protein Domains: (1..17-)
    (/note="SPX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00714-)
    (439..64-)
    (/note="EXS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00712"-)
  • Interpro: IPR004342  IPR004331  
  • Prosite: PS51380 PS51382
  • PDB: 5IJH
  • PDBsum: 5IJH
  • STRING: ENSP00000356562
• Other Databases: GeneCards:  XPR1  Malacards:  XPR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015114	phosphate ion transmembrane transporter activity	IBA	molecular function
GO:0006817	phosphate ion transport	IBA	biological process
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0000822	inositol hexakisphosphate binding	IBA	molecular function
GO:0016036	cellular response to phosphate starvation	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0000822	inositol hexakisphosphate binding	IDA	molecular function
GO:0031226	intrinsic component of plasma membrane	IDA	cellular component
GO:0001618	virus receptor activity	IMP	molecular function
GO:0015114	phosphate ion transmembrane transporter activity	IMP	molecular function
GO:0030643	cellular phosphate ion homeostasis	IMP	biological process
GO:0015562	efflux transmembrane transporter activity	IMP	molecular function
GO:0035435	phosphate ion transmembrane transport	IMP	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0001618	virus receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0009615	response to virus	IEA	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0046718	viral entry into host cell	IEA	biological process
GO:0046718	viral entry into host cell	IEA	biological process

Diseases

Associated diseases	References
Familial idiopathic basal ganglia calcification	KEGG:H01574
Familial idiopathic basal ganglia calcification	KEGG:H01574
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray