• Gene id: 9212

Gene Summary

• Gene Symbol: AURKB   Gene   UCSC   Ensembl
• Aliases: AIK2, AIM-1, AIM1, ARK-2, ARK2, AurB, IPL1, PPP1R48, STK-1, STK12, STK5, aurkb-sv1, aurkb-sv2
• Gene name: aurora kinase B
• Alternate names: aurora kinase B, aurora kinase B-Sv1, aurora kinase B-Sv2, aurora- and Ipl1-like midbody-associated protein 1, aurora-1, aurora-B, aurora-related kinase 2, aurora/IPL1-related kinase 2, protein phosphatase 1, regulatory subunit 48, serine/threonine kinase 12, serin,
• Gene location: 17p13.1 (8210766: 8204730)     Exons: 10     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the aurora kinase subfamily of serine/threonine kinases. The genes encoding the other two members of this subfamily are located on chromosomes 19 and 20. These kinases participate in the regulation of alignment and segregatio
• OMIM: 609737

Protein Summary

• Protein general information: Q96GD4  
  • Name: Aurora kinase B (EC 2.7.11.1) (Aurora 1) (Aurora and IPL1 like midbody associated protein 1) (AIM 1) (Aurora/IPL1 related kinase 2) (ARK 2) (Aurora related kinase 2) (STK 1) (Serine/threonine protein kinase 12) (Serine/threonine protein kinase 5) (Serine
  • Length: 344  
  • Mass: 39311
  • Tissue specificity: High level expression seen in the thymus. It is also expressed in the spleen, lung, testis, colon, placenta and fetal liver. Expressed during S and G2/M phase and expression is up-regulated in cancer cells during M phase. {ECO
• Sequence:

  MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTID
  DFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEHQLRREIEIQAHLHHPNILRLYNYFYDRRRI
  YLILEYAPRGELYKELQKSCTFDEQRTATIMEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHA
  PSLRRKTMCGTLDYLPPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
  QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA

• Structural information:
  • Protein Domains: (77..32-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR030616  IPR028772  IPR011009  IPR000719  IPR017441   IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 4AF3
  • PDBsum: 4AF3
  • DIP: 34530
  • STRING: ENSP00000313950
• Other Databases: GeneCards:  AURKB  Malacards:  AURKB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000776	kinetochore	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:1905116	positive regulation of lateral attachment of mitotic spindle microtubules to kinetochore	IDA	biological process
GO:0051233	spindle midzone	IBA	cellular component
GO:0032465	regulation of cytokinesis	IBA	biological process
GO:0005876	spindle microtubule	IBA	cellular component
GO:0000780	condensed nuclear chromosome, centromeric region	IBA	cellular component
GO:0035174	histone serine kinase activity	IBA	molecular function
GO:0032133	chromosome passenger complex	IBA	cellular component
GO:0031616	spindle pole centrosome	IBA	cellular component
GO:0007052	mitotic spindle organization	IBA	biological process
GO:0036089	cleavage furrow formation	IDA	biological process
GO:0034644	cellular response to UV	IDA	biological process
GO:0030496	midbody	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0002903	negative regulation of B cell apoptotic process	IDA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0051256	mitotic spindle midzone assembly	IMP	biological process
GO:0051256	mitotic spindle midzone assembly	TAS	biological process
GO:0046777	protein autophosphorylation	TAS	biological process
GO:0043988	histone H3-S28 phosphorylation	ISS	biological process
GO:0035174	histone serine kinase activity	ISS	molecular function
GO:0034501	protein localization to kinetochore	IMP	biological process
GO:0032133	chromosome passenger complex	TAS	cellular component
GO:0044878	mitotic cytokinesis checkpoint	ISS	biological process
GO:0016570	histone modification	TAS	biological process
GO:0009838	abscission	ISS	biological process
GO:0004712	protein serine/threonine/tyrosine kinase activity	TAS	molecular function
GO:0051983	regulation of chromosome segregation	TAS	biological process
GO:0032467	positive regulation of cytokinesis	IMP	biological process
GO:0032467	positive regulation of cytokinesis	TAS	biological process
GO:0032466	negative regulation of cytokinesis	ISS	biological process
GO:0030496	midbody	TAS	cellular component
GO:0008608	attachment of spindle microtubules to kinetochore	TAS	biological process
GO:0005819	spindle	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032133	chromosome passenger complex	IEA	cellular component
GO:0043988	histone H3-S28 phosphorylation	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007094	mitotic spindle assembly checkpoint	IEA	biological process
GO:0032467	positive regulation of cytokinesis	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0006468	protein phosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	EXP	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000780	condensed nuclear chromosome, centromeric region	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005819	spindle	IEA	cellular component
GO:0008283	cell population proliferation	IEA	biological process
GO:0030496	midbody	IEA	cellular component
GO:0036089	cleavage furrow formation	IEA	biological process
GO:0010369	chromocenter	IEA	cellular component
GO:0032133	chromosome passenger complex	IEA	cellular component
GO:0035174	histone serine kinase activity	IEA	molecular function
GO:0043988	histone H3-S28 phosphorylation	IEA	biological process
GO:1990023	mitotic spindle midzone	IEA	cellular component
GO:0007568	aging	IEA	biological process
GO:0032212	positive regulation of telomere maintenance via telomerase	IMP	biological process
GO:1904355	positive regulation of telomere capping	IMP	biological process
GO:0051973	positive regulation of telomerase activity	IMP	biological process
GO:0000780	condensed nuclear chromosome, centromeric region	IDA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0000779	condensed chromosome, centromeric region	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032133	chromosome passenger complex	IPI	cellular component
GO:0007051	spindle organization	IMP	biological process
GO:0032133	chromosome passenger complex	IPI	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function

Diseases

Associated diseases	References
Endometrial carcinoma	PMID:16311121
prostate carcinoma in situ	PMID:16707419
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray