• Gene id: 921

Gene Summary

• Gene Symbol: CD5   Gene   UCSC   Ensembl
• Aliases: LEU1, T1
• Gene name: CD5 molecule
• Alternate names: T-cell surface glycoprotein CD5, CD5 antigen (p56-62), epididymis secretory sperm binding protein, lymphocyte antigen T1/Leu-1,
• Gene location: 11q12.2 (61093962: 61127851)     Exons: 12     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. This protein is a type-I transmembrane glycop
• OMIM: 611007

Protein Summary

• Protein general information: P06127  
  • Name: T cell surface glycoprotein CD5 (Lymphocyte antigen T1/Leu 1) (CD antigen CD5)
  • Length: 495  
  • Mass: 54578
• Sequence:

  MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPS
  QASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTT
  PEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPG
  EPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAAL
  CDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGL
  AAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVD
  NEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL

• Structural information:
  • Protein Domains: (35..13-)
    (/note="SRCR-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00196-)
    (159..26-)
    (/note="SRCR-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00196-)
    (276..36-)
    (/note="SRCR-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00196"-)
  • Interpro: IPR001190  IPR017448  IPR036772  IPR003566  
  • Prosite: PS50287
  • PDB: 2JA4 2JOP 2JP0 2OTT
  • PDBsum: 2JA4 2JOP 2JP0 2OTT
  • DIP: 21
  • STRING: ENSP00000342681
• Other Databases: GeneCards:  CD5  Malacards:  CD5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006897	endocytosis	IEA	biological process
GO:0038023	signaling receptor activity	NAS	molecular function
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008037	cell recognition	NAS	biological process
GO:0005044	scavenger receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0031295	T cell costimulation	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0031295	T cell costimulation	IEA	biological process
GO:0097190	apoptotic signaling pathway	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04640	Hematopoietic cell lineage

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R