• Gene id: 92086

Gene Summary

• Gene Symbol: GGTLC1   Gene   UCSC   Ensembl
• Aliases: GGTL6, GGTLA3, GGTLA4, dJ831C21.1, dJ831C21.2
• Gene name: gamma-glutamyltransferase light chain 1
• Alternate names: glutathione hydrolase light chain 1, gamma-glutamyl transpeptidase, gamma-glutamyltransferase-like activity 3, gamma-glutamyltransferase-like activity 4, gamma-glutamyltransferase-like protein 6,
• Gene location: 20p11.21 (23989133: 23985052)     Exons: 8     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the gamma-glutamyl transpeptidase (GGT) family, which are important in the metabolism of glutathione. The most ubiquitously expressed human GGT gene, GGT1, encodes a single transmembrane polypeptide that is post-translational
• OMIM: 612338

Protein Summary

• Protein general information: Q9BX51  
  • Name: Glutathione hydrolase light chain 1 (Gamma glutamyltransferase light chain 1) (Gamma glutamyltransferase like activity 4) (Gamma glutamyltransferase like protein 6)
  • Length: 225  
  • Mass: 24274
• Sequence:

  MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILLNN
  EMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITMATALAIIYNLWFGYD
  VKWAVEEPRLHNQLLPNVTTVERNIDQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY

• Structural information:
  • Interpro: IPR000101  IPR029055  
  • Prosite: PS00462
  • STRING: ENSP00000337587
• Other Databases: GeneCards:  GGTLC1  Malacards:  GGTLC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006751	glutathione catabolic process	IEA	biological process
GO:0036374	glutathione hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:1901750	leukotriene D4 biosynthetic process	ISS	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)