Male Infertility Database

Search Result

Gene id

92014

Gene Summary Protein Summary Gene ontology Diseases PubMed

Gene Summary

Gene Symbol

SLC25A51 Gene UCSC Ensembl

Aliases

CG7943, MCART1

Gene name

solute carrier family 25 member 51

Alternate names

solute carrier family 25 member 51, mitochondrial carrier triple repeat 1, mitochondrial carrier triple repeat protein 1,

Gene location

9p13.2-p13.1 (37904352: 37877574) Exons: 6 NC_000009.12

Protein Summary

Protein general information

Q9H1U9

Name: Solute carrier family 25 member 51 (Mitochondrial carrier triple repeat protein 1)

Length: 297 Mass: 33672

Sequence

MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITFPIQKVLFRQQLYGIKTRDAILQLRRD
GFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLHKHVSAPEFATSGVAAVLAGTTEAIFTPLERVQTLLQDHKH
HDKFTNTYQAFKALKCHGIGEYYRGLVPILFRNGLSNVLFFGLRGPIKEHLPTATTHSAHLVNDFICGGLLGAML
GFLFFPINVVKTRIQSQIGGEFQSFPKVFQKIWLERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKVI

Structural information

Interpro:	IPR018108 IPR023395
Prosite:	PS50920
STRING:	ENSP00000366945

Other Databases

GeneCards: SLC25A51 Malacards: SLC25A51

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membr ane	IEA	cellular component
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membr ane	IEA	cellular component

Diseases

Expand All | Collapse All

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
17327269	Teratozoos permia	13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
21674046	Aberrant C pGs in Low Motility Sperm	18	Male infertility	GSE26881	Show abstract
31037746	Spermatoge nic defect s	28 men with az oospermia	Male infertility	Microarray	Show abstract
31037746	Spermatoge nic defect s	16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Diseases

Expand All | Collapse All