• Gene id: 9201

Gene Summary

• Gene Symbol: DCLK1   Gene   UCSC   Ensembl
• Aliases: CL1, CLICK1, DCAMKL1, DCDC3A, DCLK
• Gene name: doublecortin like kinase 1
• Alternate names: serine/threonine-protein kinase DCLK1, doublecortin domain-containing protein 3A, doublecortin-like and CAM kinase-like 1,
• Gene location: 13q13.3 (36131938: 35768651)     Exons: 21     NC_000013.11
• Gene summary(Entrez): This gene encodes a member of the protein kinase superfamily and the doublecortin family. The protein encoded by this gene contains two N-terminal doublecortin domains, which bind microtubules and regulate microtubule polymerization, a C-terminal serine/t
• OMIM: 604742

Protein Summary

• Protein general information: O15075  
  • Name: Serine/threonine protein kinase DCLK1 (EC 2.7.11.1) (Doublecortin domain containing protein 3A) (Doublecortin like and CAM kinase like 1) (Doublecortin like kinase 1)
  • Length: 740  
  • Mass: 82224
  • Tissue specificity: In fetal tissues, highly expressed in brain, detectable in lung and liver, but not in kidney. In adult tissues, expressed ubiquitously in the brain, detectable in the heart, liver, spleen, thymus, prostate, testis, ovary, small intesti
• Sequence:

  MSFGRDMELEHFDERDKAQRYSRGSRVNGLPSPTHSAHCSFYRTRTLQTLSSEKKAKKVRFYRNGDRYFKGIVYA
  ISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTIDGLKKISSLDQLVEGESYVCGSIEPFKKLEYTKNVNPNW
  SVNVKTTSASRAVSSLATAKGSPSEVRENKDFIRPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIK
  LDSGVVKRLYTLDGKQVMCLQDFFGDDDIFIACGPEKFRYQDDFLLDESECRVVKSTSYTKIASSSRRSTTKSPG
  PSRRSKSPASTSSVNGTPGSQLSTPRSGKSPSPSPTSPGSLRKQRSSQHGGSSTSLASTKVCSSMDENDGPGEEV
  SEEGFQIPATITERYKVGRTIGDGNFAVVKECVERSTAREYALKIIKKSKCRGKEHMIQNEVSILRRVKHPNIVL
  LIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDASGMLYNLASAIKYLHSLNIVHRDIKPENLLVYEHQDG
  SKSLKLGDFGLATIVDGPLYTVCGTPTYVAPEIIAETGYGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQ
  ILMGQVDFPSPYWDNVSDSAKELITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKP
  NSTAAGVSVIATTALDKERQVFRRRRNQDVRSRYKAQPAPPELNSESEDYSPSSSETVRSPNSPF

• Structural information:
  • Protein Domains: (57..14-)
    (/note="Doublecortin-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00072-)
    (186..26-)
    (/note="Doublecortin-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00072-)
    (390..64-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROS-)
  • Interpro: IPR003533  IPR036572  IPR011009  IPR000719  IPR017441   IPR008271  
  • Prosite: PS50309 PS00107 PS50011 PS00108
  • PDB: 1MFW 1MG4 1UF0 5JZJ 5JZN
  • PDBsum: 1MFW 1MG4 1UF0 5JZJ 5JZN
  • STRING: ENSP00000255448
• Other Databases: GeneCards:  DCLK1  Malacards:  DCLK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048812	neuron projection morphogenesis	IBA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0007399	nervous system development	IEA	biological process
GO:0004672	protein kinase activity	TAS	molecular function
GO:0007417	central nervous system development	TAS	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006468	protein phosphorylation	TAS	biological process
GO:0007399	nervous system development	TAS	biological process
GO:1900181	negative regulation of protein localization to nucleus	IEA	biological process
GO:0048813	dendrite morphogenesis	IEA	biological process
GO:0048675	axon extension	IEA	biological process
GO:0018105	peptidyl-serine phosphorylation	IEA	biological process
GO:0001764	neuron migration	IEA	biological process
GO:0030900	forebrain development	IEA	biological process
GO:0021952	central nervous system projection neuron axonogenesis	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0007420	brain development	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0016197	endosomal transport	NAS	biological process
GO:0009615	response to virus	IEP	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq