• Gene id: 920

Gene Summary

• Gene Symbol: CD4   Gene   UCSC   Ensembl
• Aliases: CD4mut
• Gene name: CD4 molecule
• Alternate names: T-cell surface glycoprotein CD4, CD4 antigen (p55), CD4 receptor, T-cell surface antigen T4/Leu-3,
• Gene location: 12p13.31 (6789527: 6820809)     Exons: 10     NC_000012.12
• Gene summary(Entrez): This gene encodes the CD4 membrane glycoprotein of T lymphocytes. The CD4 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class II MHC molecules. The
• OMIM: 617683

Protein Summary

• Protein general information: P01730  
  • Name: T cell surface glycoprotein CD4 (T cell surface antigen T4/Leu 3) (CD antigen CD4)
  • Length: 458  
  • Mass: 51111
  • Tissue specificity: Highly expressed in T-helper cells. The presence of CD4 is a hallmark of T-helper cells which are specialized in the activation and growth of cytotoxic T-cells, regulation of B cells, or activation of phagocytes. CD4 is also present in
• Sequence:

  MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSK
  LNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESPPGSS
  PSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPL
  AFTVEKLTGSGELWWQAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLA
  LEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWVLNPEAGMWQCLLSDS
  GQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERMSQIKRLLSEKKTCQCPHR
  FQKTCSPI

• Structural information:
  • Protein Domains: (26..12-)
    (/note="Ig-like-V-type)
    (126..20-)
    1 (/note="Ig-like-C2-type)
    (204..31-)
    2 (/note="Ig-like-C2-type)
    (318..37-)
    3" (/note="Ig-like-C2-type)
  • Interpro: IPR000973  IPR015274  IPR007110  IPR036179  IPR013783   IPR008424  IPR003599  IPR003598  IPR013106  IPR013151  IPR021963  
  • Prosite: PS50835
  • PDB: 1CDH 1CDI 1CDJ 1CDU 1CDY 1G9M 1G9N 1GC1 1JL4 1OPN 1OPT 1OPW 1Q68 1RZJ 1RZK 1WBR 1WIO 1WIP 1WIQ 2B4C 2JKR 2JKT 2KLU 2NXY 2NXZ 2NY0 2NY1 2NY2 2NY3 2NY4 2NY5 2NY6 2QAD 3B71 3CD4 3J70 3JCB 3JCC 3JWD 3JWO 3LQA 3O2D 3S4S 3S5L 3T0E 4H8W 4JM2 4P9H 4Q6I 4R2G 4R4H 4RQS 5A7X 5A8H 5CAY 5THR 5U1F 5VN3 6CM3 6EDU 6MEO 6MET 6QH6 6QH
  • PDBsum: 1CDH 1CDI 1CDJ 1CDU 1CDY 1G9M 1G9N 1GC1 1JL4 1OPN 1OPT 1OPW 1Q68 1RZJ 1RZK 1WBR 1WIO 1WIP 1WIQ 2B4C 2JKR 2JKT 2KLU 2NXY 2NXZ 2NY0 2NY1 2NY2 2NY3 2NY4 2NY5 2NY6 2QAD 3B71 3CD4 3J70 3JCB 3JCC 3JWD 3JWO 3LQA 3O2D 3S4S 3S5L 3T0E 4H8W 4JM2 4P9H 4Q6I 4R2G 4R4H 4RQS 5A7X 5A8H 5CAY 5THR 5U1F 5VN3 6CM3 6EDU 6MEO 6MET 6QH6 6QH
  • DIP: 617
  • STRING: ENSP00000011653
• Other Databases: GeneCards:  CD4  Malacards:  CD4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030225	macrophage differentiation	IMP	biological process
GO:0045121	membrane raft	IBA	cellular component
GO:0042110	T cell activation	IBA	biological process
GO:0007165	signal transduction	IBA	biological process
GO:1990782	protein tyrosine kinase binding	IBA	molecular function
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0042289	MHC class II protein binding	IBA	molecular function
GO:0035723	interleukin-15-mediated signaling pathway	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0042289	MHC class II protein binding	IDA	molecular function
GO:0042289	MHC class II protein binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990782	protein tyrosine kinase binding	IPI	molecular function
GO:0006955	immune response	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0015026	coreceptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0001618	virus receptor activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0015026	coreceptor activity	TAS	molecular function
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007167	enzyme linked receptor protein signaling pathway	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0032507	maintenance of protein location in cell	IDA	biological process
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005769	early endosome	TAS	cellular component
GO:0005769	early endosome	TAS	cellular component
GO:0005769	early endosome	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050690	regulation of defense response to virus by virus	TAS	biological process
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0019064	fusion of virus membrane with host plasma membrane	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0061024	membrane organization	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010524	positive regulation of calcium ion transport into cytosol	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0042110	T cell activation	IEA	biological process
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0035397	helper T cell enhancement of adaptive immune response	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0050850	positive regulation of calcium-mediated signaling	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0019865	immunoglobulin binding	IEA	molecular function
GO:0019901	protein kinase binding	IEA	molecular function
GO:0033280	response to vitamin D	IEA	biological process
GO:0042102	positive regulation of T cell proliferation	IEA	biological process
GO:1990782	protein tyrosine kinase binding	IEA	molecular function
GO:0001816	cytokine production	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0050829	defense response to Gram-negative bacterium	IEA	biological process
GO:0050870	positive regulation of T cell activation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0035723	interleukin-15-mediated signaling pathway	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0045657	positive regulation of monocyte differentiation	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0042011	interleukin-16 binding	IPI	molecular function
GO:0051924	regulation of calcium ion transport	IDA	biological process
GO:0097011	cellular response to granulocyte macrophage colony-stimulating factor stimulus	IDA	biological process
GO:0033674	positive regulation of kinase activity	IDA	biological process
GO:0042289	MHC class II protein binding	IPI	molecular function
GO:0046598	positive regulation of viral entry into host cell	IDA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0042012	interleukin-16 receptor activity	IDA	molecular function
GO:0050863	regulation of T cell activation	IDA	biological process
GO:0008270	zinc ion binding	IDA	molecular function
GO:0045058	T cell selection	IDA	biological process
GO:0030217	T cell differentiation	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0006948	induction by virus of host cell-cell fusion	IDA	biological process
GO:0045860	positive regulation of protein kinase activity	IDA	biological process
GO:0005201	extracellular matrix structural constituent	NAS	molecular function
GO:0042289	MHC class II protein binding	NAS	molecular function
GO:0015026	coreceptor activity	NAS	molecular function
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	NAS	biological process
GO:0006955	immune response	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045086	positive regulation of interleukin-2 biosynthetic process	NAS	biological process
GO:0042101	T cell receptor complex	NAS	cellular component
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa05166	Human T-cell leukemia virus 1 infection
hsa05170	Human immunodeficiency virus 1 infection
hsa04514	Cell adhesion molecules
hsa04660	T cell receptor signaling pathway
hsa04659	Th17 cell differentiation
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa04658	Th1 and Th2 cell differentiation
hsa04640	Hematopoietic cell lineage
hsa04612	Antigen processing and presentation
hsa05340	Primary immunodeficiency

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq