• Gene id: 91966

Gene Summary

• Gene Symbol: EOLA1   Gene   UCSC   Ensembl
• Aliases: CXorf40, CXorf40A
• Gene name: endothelium and lymphocyte associated ASCH domain 1
• Alternate names: protein EOLA1, protein CXorf40A, endothelial-overexpressed lipopolysaccharide-associated factor 1,
• Gene location: Xq28 (149540600: 149555344)     Exons: 8     NC_000023.11
• OMIM: 300954

Protein Summary

• Protein general information: Q8TE69  
  • Name: Protein EOLA1 (Endothelial overexpressed lipopolysaccharide associated factor 1) (Endothelium and lymphocyte associated ASCH domain 1)
  • Length: 158  
  • Mass: 17891
  • Tissue specificity: Expressed primarily in heart, skeletal muscle, kidney, liver and placenta. Relatively high level of expression in spleen, colon and small intestine. Almost no expression in brain, thymus, lung and peripheral blood leukocytes. Expressed
• Sequence:

  MKFGCLSFRQPYAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWEGDAWRELLVERLGMTPAQIQALLRKG
  EKFGRGVIAGLVDIGETLQCPEDLTPDEVVELENQAVLTNLKQKYLTVISNPRWLLEPIPRKGGKDVFQVDIPEH
  LIPLGHEV

• Structural information:
  • Interpro: IPR007374  IPR033615  IPR015947  
  • PDB: 5Y7D
  • PDBsum: 5Y7D
  • STRING: ENSP00000423099
• Other Databases: GeneCards:  EOLA1  Malacards:  EOLA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010468	regulation of gene expression	IDA	biological process
GO:0032675	regulation of interleukin-6 production	IDA	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881