• Gene id: 9196

Gene Summary

• Gene Symbol: KCNAB3   Gene   UCSC   Ensembl
• Aliases: AKR6A9, KCNA3.1B, KCNA3B, KV-BETA-3
• Gene name: potassium voltage-gated channel subfamily A regulatory beta subunit 3
• Alternate names: voltage-gated potassium channel subunit beta-3, K(+) channel subunit beta-3, potassium channel, voltage gated subfamily A regulatory beta subunit 3, potassium channel, voltage-dependent, beta-3 subunit, potassium voltage-gated channel, shaker-related subfamil,
• Gene location: 17p13.1 (7930345: 7921858)     Exons: 14     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. The encoded protein is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. The encoded protein forms a heterodi
• OMIM: 176261

Protein Summary

• Protein general information: O43448  
  • Name: Voltage gated potassium channel subunit beta 3 (K(+) channel subunit beta 3) (Kv beta 3)
  • Length: 404  
  • Mass: 43670
  • Tissue specificity: Brain specific. Most prominent expression in cerebellum. Weaker signals detected in cortex, occipital lobe, frontal lobe and temporal lobe. Not detected in spinal cord, heart, lung, liver, kidney, pancreas, placenta and skeletal muscle
• Sequence:

  MQVSIACTEQNLRSRSSEDRLCGPRPGPGGGNGGPAGGGHGNPPGGGGSGPKARAALVPRPPAPAGALRESTGRG
  TGMKYRNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEVYAAGKAERTLGNILKSKGWR
  RSSYVITTKIFWGGQAETERGLSRKHIIEGLRGSLERLQLGYVDIVFANRSDPNCPMEEIVRAMTYVINQGLALY
  WGTSRWGAAEIMEAYSMARQFNLIPPVCEQAEHHLFQREKVEMQLPELYHKIGVGSVTWYPLACGLITSKYDGRV
  PDTCRASIKGYQWLKDKVQSEDGKKQQAKVMDLLPVAHQLGCTVAQLAIAWCLRSEGVSSVLLGVSSAEQLIEHL
  GALQVLSQLTPQTVMEIDGLLGNKPHSKK

• Structural information:
  • Interpro: IPR005983  IPR005399  IPR005402  IPR023210  IPR036812  
  • CDD: cd06660
  • STRING: ENSP00000302719
• Other Databases: GeneCards:  KCNAB3  Malacards:  KCNAB3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0005249	voltage-gated potassium channel activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006813	potassium ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0044325	ion channel binding	IBA	molecular function
GO:1901379	regulation of potassium ion transmembrane transport	IBA	biological process
GO:0015459	potassium channel regulator activity	IBA	molecular function
GO:0008076	voltage-gated potassium channel complex	IBA	cellular component
GO:0004033	aldo-keto reductase (NADP) activity	IBA	molecular function
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0015459	potassium channel regulator activity	TAS	molecular function
GO:0006813	potassium ion transport	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R