• Gene id: 91949

Gene Summary

• Gene Symbol: COG7   Gene   UCSC   Ensembl
• Aliases: CDG2E
• Gene name: component of oligomeric golgi complex 7
• Alternate names: conserved oligomeric Golgi complex subunit 7, COG complex subunit 7,
• Gene location: 16p12.2 (23453214: 23388492)     Exons: 17     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene resides in the golgi, and constitutes one of the 8 subunits of the conserved oligomeric Golgi (COG) complex, which is required for normal golgi morphology and localization. Mutations in this gene are associated with the co
• OMIM: 612038

Protein Summary

• Protein general information: P83436  
  • Name: Conserved oligomeric Golgi complex subunit 7 (COG complex subunit 7) (Component of oligomeric Golgi complex 7)
  • Length: 770  
  • Mass: 86344
• Sequence:

  MDFSKFLADDFDVKEWINAAFRAGSKEAASGKADGHAATLVMKLQLFIQEVNHAVEETSHQALQNMPKVLRDVEA
  LKQEASFLKEQMILVKEDIKKFEQDTSQSMQVLVEIDQVKSRMQLAAESLQEADKWSTLSADIEETFKTQDIAVI
  SAKLTGMQNSLMMLVDTPDYSEKCVHLEALKNRLEALASPQIVAAFTSQAVDQSKVFVKVFTEIDRMPQLLAYYY
  KCHKVQLLAAWQELCQSDLSLDRQLTGLYDALLGAWHTQIQWATQVFQKPHEVVMVLLIQTLGALMPSLPSCLSN
  GVERAGPEQELTRLLEFYDATAHFAKGLEMALLPHLHEHNLVKVTELVDAVYDPYKPYQLKYGDMEESNLLIQMS
  AVPLEHGEVIDCVQELSHSVNKLFGLASAAVDRCVRFTNGLGTCGLLSALKSLFAKYVSDFTSTLQSIRKKCKLD
  HIPPNSLFQEDWTAFQNSIRIIATCGELLRHCGDFEQQLANRILSTAGKYLSDSCSPRSLAGFQESILTDKKNSA
  KNPWQEYNYLQKDNPAEYASLMEILYTLKEKGSSNHNLLAAPRAALTRLNQQAHQLAFDSVFLRIKQQLLLISKM
  DSWNTAGIGETLTDELPAFSLTPLEYISNIGQYIMSLPLNLEPFVTQEDSALELALHAGKLPFPPEQGDELPELD
  NMADNWLGSIARATMQTYCDAILQIPELSPHSAKQLATDIDYLINVMDALGLQPSRTLQHIVTLLKTRPEDYRQV
  SKGLPRRLATTVATMRSVNY

• Structural information:
  • Interpro: IPR019335  
  • STRING: ENSP00000305442
• Other Databases: GeneCards:  COG7  Malacards:  COG7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IBA	biological process
GO:0007030	Golgi organization	IBA	biological process
GO:0017119	Golgi transport complex	IBA	cellular component
GO:0006886	intracellular protein transport	IEA	biological process
GO:0017119	Golgi transport complex	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0017119	Golgi transport complex	IDA	cellular component
GO:0033365	protein localization to organelle	IMP	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IMP	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IMP	biological process
GO:0006886	intracellular protein transport	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0050821	protein stabilization	IMP	biological process
GO:0006486	protein glycosylation	IMP	biological process
GO:0006486	protein glycosylation	IMP	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0034067	protein localization to Golgi apparatus	IMP	biological process

Diseases

Associated diseases	References
Congenital disorders of glycosylation type II	KEGG:H00119
Congenital disorders of glycosylation type II	KEGG:H00119
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881