• Gene id: 9194

Gene Summary

• Gene Symbol: SLC16A7   Gene   UCSC   Ensembl
• Aliases: MCT2
• Gene name: solute carrier family 16 member 7
• Alternate names: monocarboxylate transporter 2, solute carrier family 16 (monocarboxylate transporter), member 7, solute carrier family 16, member 7 (monocarboxylic acid transporter 2),
• Gene location: 12q14.1 (59595933: 59789854)     Exons: 14     NC_000012.12
• Gene summary(Entrez): This gene is a member of the monocarboxylate transporter family. Members in this family transport metabolites, such as lactate, pyruvate, and ketone bodies. The protein encoded by this gene catalyzes the proton-linked transport of monocarboxylates and has
• OMIM: 603654

SNPs

rs10506398

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.59717545A>C
NC_000012.12   g.59717545A>G
NC_000012.11   g.60111326A>C
NC_000012.11   g.60111326A>G|SEQ=[A/C/G]|GENE=SLC16A7

rs10506399

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.59780712G>A
NC_000012.12   g.59780712G>C
NC_000012.11   g.60174493G>A
NC_000012.11   g.60174493G>C
NM_004731.4   c.*1033G>A
NM_004731.4   c.*1033G>C
NM_004731.5   c.*1033G>A
NM_004731.5   c.*1033G>C
XM_005269231.4   c.*1033G>A
XM_005269231.4   c.*1033G>

Protein Summary

• Protein general information: O60669  
  • Name: Monocarboxylate transporter 2 (MCT 2) (Solute carrier family 16 member 7)
  • Length: 478  
  • Mass: 52,200
• Sequence:

  MPPMPSAPPVHPPPDGGWGWIVVGAAFISIGFSYAFPKAVTVFFKEIQQIFHTTYSEIAWISSIMLAVMYAGGPV
  SSVLVNKYGSRPVVIAGGLLCCLGMVLASFSSSVVQLYLTMGFITGLGLAFNLQPALTIIGKYFYRKRPMANGLA
  MAGSPVFLSSLAPFNQYLFNTFGWKGSFLILGSLLLNACVAGSLMRPLGPNQTTSKSKNKTGKTEDDSSPKKIKT
  KKSTWEKVNKYLDFSLFKHRGFLIYLSGNVIMFLGFFAPIIFLAPYAKDQGIDEYSAAFLLSVMAFVDMFARPSV
  GLIANSKYIRPRIQYFFSFAIMFNGVCHLLCPLAQDYTSLVLYAVFFGLGFGSVSSVLFETLMDLVGAPRFSSAV
  GLVTIVECGPVLLGPPLAGKLVDLTGEYKYMYMSCGAIVVAASVWLLIGNAINYRLLAKERKEENARQKTRESEP
  LSKSKHSEDVNVKVSNAQSVTSERETNI

• Structural information:
  • Interpro: IPR004743  IPR027178  IPR011701  IPR020846  IPR036259  
  • Prosite: PS50850
  • CDD: cd06174
  • STRING: ENSP00000261187
• Other Databases: GeneCards:  SLC16A7  Malacards:  SLC16A7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005477	pyruvate secondary active transmembrane transporter activity	TAS	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0008028	monocarboxylic acid transmembrane transporter activity	TAS	molecular function
GO:0015129	lactate transmembrane transporter activity	IDA	molecular function
GO:0015293	symporter activity	IEA	molecular function
GO:0035873	lactate transmembrane transport	IMP	biological process
GO:0035879	plasma membrane lactate transport	IBA	biological process
GO:0050833	pyruvate transmembrane transporter activity	IDA	molecular function
GO:1901475	pyruvate transmembrane transport	IDA	biological process
GO:0005477	pyruvate secondary active transmembrane transporter activity	TAS	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0006810	transport	IEA	biological process
GO:0008028	monocarboxylic acid transmembrane transporter activity	IEA	molecular function
GO:0008028	monocarboxylic acid transmembrane transporter activity	TAS	molecular function
GO:0015129	lactate transmembrane transporter activity	IDA	molecular function
GO:0015293	symporter activity	IEA	molecular function
GO:0015718	monocarboxylic acid transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0035873	lactate transmembrane transport	IMP	biological process
GO:0035879	plasma membrane lactate transport	IEA	biological process
GO:0035879	plasma membrane lactate transport	IBA	biological process
GO:0050833	pyruvate transmembrane transporter activity	IDA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:1901475	pyruvate transmembrane transport	IEA	biological process
GO:1901475	pyruvate transmembrane transport	IDA	biological process
GO:0005477	pyruvate secondary active transmembrane transporter activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0008028	monocarboxylic acid transmembrane transporter activity	TAS	molecular function
GO:0015129	lactate transmembrane transporter activity	IDA	molecular function
GO:0035873	lactate transmembrane transport	IMP	biological process
GO:0035879	plasma membrane lactate transport	IBA	biological process
GO:0050833	pyruvate transmembrane transporter activity	IDA	molecular function
GO:1901475	pyruvate transmembrane transport	IDA	biological process

Diseases

Associated diseases	References
Oligoasthenoteratozoospermia	MIK: 24799634
Hypospermatogenesis	MIK: 28361989
Male infertility, oligoasthenoteratozoospermia	MIK: 24799634
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24799634	Male infertility, oligoasthenoteratozoospermia	MCT2 (intron 2 (+28201A > G, rs10506398) and 3' untranslated region (UTR) single nucleotide polymorphism (SNP) (+2626G > A, rs10506399)		471 male infertility	Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R