• Gene id: 9191

Gene Summary

• Gene Symbol: DEDD   Gene   UCSC   Ensembl
• Aliases: CASP8IP1, DEDD1, DEFT, FLDED1, KE05
• Gene name: death effector domain containing
• Alternate names: death effector domain-containing protein, DEDPro1, FLDED-1, death effector domain-containing testicular molecule,
• Gene location: 1q23.3 (161132782: 161120973)     Exons: 8     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein that contains a death effector domain (DED). DED is a protein-protein interaction domain shared by adaptors, regulators and executors of the programmed cell death pathway. Overexpression of this gene was shown to induce weak ap
• OMIM: 606841

Protein Summary

• Protein general information: O75618  
  • Name: Death effector domain containing protein (DEDPro1) (Death effector domain containing testicular molecule) (FLDED 1)
  • Length: 318  
  • Mass: 36794
  • Tissue specificity: Widely expressed with highest levels in testis. {ECO
• Sequence:

  MAGLKRRASQVWPEEHGEQEHGLYSLHRMFDIVGTHLTHRDVRVLSFLFVDVIDDHERGLIRNGRDFLLALERQG
  RCDESNFRQVLQLLRIITRHDLLPYVTLKRRRAVCPDLVDKYLEETSIRYVTPRALSDPEPRPPQPSKTVPPHYP
  VVCCPTSGPQMCSKRPARGRATLGSQRKRRKSVTPDPKEKQTCDIRLRVRAEYCQHETALQGNVFSNKQDPLERQ
  FERFNQANTILKSRDLGSIICDIKFSELTYLDAFWRDYINGSLLEALKGVFITDSLKQAVGHEAIKLLVNVDEED
  YELGRQKLLRNLMLQALP

• Structural information:
  • Protein Domains: (25..10-)
    (/note="DED-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00065"-)
  • Interpro: IPR011029  IPR001875  IPR038856  
  • Prosite: PS50168
  • DIP: 41944
  • STRING: ENSP00000356985
• Other Databases: GeneCards:  DEDD  Malacards:  DEDD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003677	DNA binding	IBA	molecular function
GO:0005730	nucleolus	IBA	cellular component
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IBA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0005730	nucleolus	TAS	cellular component
GO:0007283	spermatogenesis	TAS	biological process
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003677	DNA binding	ISS	molecular function
GO:0005730	nucleolus	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)