• Gene id: 9188

Gene Summary

• Gene Symbol: DDX21   Gene   UCSC   Ensembl
• Aliases: GUA, GURDB, RH-II/GU, RH-II/GuA
• Gene name: DExD-box helicase 21
• Alternate names: nucleolar RNA helicase 2, DEAD (Asp-Glu-Ala-Asp) box helicase 21, DEAD (Asp-Glu-Ala-Asp) box polypeptide 21, DEAD box protein 21, DEAD-box helicase 21, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 21, Gu protein, RH II/Gu, RNA helicase II/Gu alpha, gu-alpha, nucleo,
• Gene location: 10q22.1 (8514166: 8509677)     Exons: 8     NC_000019.10
• Gene summary(Entrez): DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and m
• OMIM: 606357

Protein Summary

• Protein general information: Q9NR30  
  • Name: Nucleolar RNA helicase 2 (EC 3.6.4.13) (DEAD box protein 21) (Gu alpha) (Nucleolar RNA helicase Gu) (Nucleolar RNA helicase II) (RH II/Gu)
  • Length: 783  
  • Mass: 87344
• Sequence:

  MPGKLRSDAGLESDTAMKKGETLRKQTEEKEKKEKPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMNSPKSK
  KAKKKEEPSQNDISPKTKSLRKKKEPIEKKVVSSKTKKVTKNEEPSEEEIDAPKPKKMKKEKEMNGETREKSPKL
  KNGFPHPEPDCNPSEAASEESNSEIEQEIPVEQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKD
  LIAQARTGTGKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDFSDITKKLSVACFYGGTPYGG
  QFERMRNGIDILVGTPGRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEEILSVAYKKDSEDNPQTLLFS
  ATCPHWVFNVAKKYMKSTYEQVDLIGKKTQKTAITVEHLAIKCHWTQRAAVIGDVIRVYSGHQGRTIIFCETKKE
  AQELSQNSAIKQDAQSLHGDIPQKQREITLKGFRNGSFGVLVATNVAARGLDIPEVDLVIQSSPPKDVESYIHRS
  GRTGRAGRTGVCICFYQHKEEYQLVQVEQKAGIKFKRIGVPSATEIIKASSKDAIRLLDSVPPTAISHFKQSAEK
  LIEEKGAVEALAAALAHISGATSVDQRSLINSNVGFVTMILQCSIEMPNISYAWKELKEQLGEEIDSKVKGMVFL
  KGKLGVCFDVPTASVTEIQEKWHDSRRWQLSVATEQPELEGPREGYGGFRGQREGSRGFRGQRDGNRRFRGQREG
  SRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQ

• Structural information:
  • Protein Domains: (217..39-)
    (/note="Helicase-ATP-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00541-)
    (429..57-)
    (/note="Helicase-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00542"-)
  • Interpro: IPR011545  IPR012562  IPR014001  IPR001650  IPR027417   IPR035979  IPR014014  
  • Prosite: PS51192 PS51194 PS51195
  • PDB: 2M3D
  • PDBsum: 2M3D
  • DIP: 32941
  • STRING: ENSP00000346120
• Other Databases: GeneCards:  DDX21  Malacards:  DDX21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005730	nucleolus	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0003724	RNA helicase activity	IBA	molecular function
GO:0019843	rRNA binding	IDA	molecular function
GO:0097322	7SK snRNA binding	IDA	molecular function
GO:0030515	snoRNA binding	IDA	molecular function
GO:0003724	RNA helicase activity	IDA	molecular function
GO:0035198	miRNA binding	IDA	molecular function
GO:0005730	nucleolus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0062176	R-loop disassembly	IDA	biological process
GO:0003724	RNA helicase activity	IDA	molecular function
GO:0006366	transcription by RNA polymerase II	IMP	biological process
GO:0003724	RNA helicase activity	IMP	molecular function
GO:0005829	cytosol	ISS	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004386	helicase activity	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0004386	helicase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0006364	rRNA processing	IEA	biological process
GO:0003724	RNA helicase activity	TAS	molecular function
GO:0005730	nucleolus	TAS	cellular component
GO:0003724	RNA helicase activity	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0045815	positive regulation of gene expression, epigenetic	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043330	response to exogenous dsRNA	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0009615	response to virus	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0002735	positive regulation of myeloid dendritic cell cytokine production	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0003725	double-stranded RNA binding	IEA	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0001649	osteoblast differentiation	HDA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881