• Gene id: 9182

Gene Summary

• Gene Symbol: RASSF9   Gene   UCSC   Ensembl
• Aliases: P-CIP1, PAMCI, PCIP1
• Gene name: Ras association domain family member 9
• Alternate names: ras association domain-containing protein 9, PAM COOH-terminal interactor protein 1, Ras association (RalGDS/AF-6) domain family (N-terminal) member 9, peptidylglycine alpha-amidating monooxygenase COOH-terminal interactor protein-1,
• Gene location: 12q21.31 (85836408: 85800702)     Exons: 3     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene localizes to perinuclear endosomes. This protein associates with peptidylglycine alpha-amidating monooxygenase, and may be involved with the trafficking of this enzyme through secretory or endosomal pathways. [provided by
• OMIM: 611110

Protein Summary

• Protein general information: O75901  
  • Name: Ras association domain containing protein 9 (PAM COOH terminal interactor protein 1) (P CIP1) (Peptidylglycine alpha amidating monooxygenase COOH terminal interactor)
  • Length: 435  
  • Mass: 50021
• Sequence:

  MAPFGRNLLKTRHKNRSPTKDMDSEEKEIVVWVCQEEKLVCGLTKRTTSADVIQALLEEHEATFGEKRFLLGKPS
  DYCIIEKWRGSERVLPPLTRILKLWKAWGDEQPNMQFVLVKADAFLPVPLWRTAEAKLVQNTEKLWELSPANYMK
  TLPPDKQKRIVRKTFRKLAKIKQDTVSHDRDNMETLVHLIISQDHTIHQQVKRMKELDLEIEKCEAKFHLDRVEN
  DGENYVQDAYLMPSFSEVEQNLDLQYEENQTLEDLSESDGIEQLEERLKYYRILIDKLSAEIEKEVKSVCIDINE
  DAEGEAASELESSNLESVKCDLEKSMKAGLKIHSHLSGIQKEIKYSDSLLQMKAKEYELLAKEFNSLHISNKDGC
  QLKENRAKESEVPSSNGEIPPFTQRVFSNYTNDTDSDTGISSNHSQDSETTVGDVVLLST

• Structural information:
  • Protein Domains: (25..11-)
    (/note="Ras-associating-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00166"-)
  • Interpro: IPR033593  IPR000159  IPR033633  IPR029071  
  • Prosite: PS50200
  • STRING: ENSP00000354884
• Other Databases: GeneCards:  RASSF9  Malacards:  RASSF9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0055037	recycling endosome	IBA	cellular component
GO:0046907	intracellular transport	IBA	biological process
GO:0012510	trans-Golgi network transport vesicle membrane	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0005768	endosome	IBA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016197	endosomal transport	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0012510	trans-Golgi network transport vesicle membrane	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0006605	protein targeting	NAS	biological process
GO:0016197	endosomal transport	NAS	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray