• Gene id: 9180

Gene Summary

• Gene Symbol: OSMR   Gene   UCSC   Ensembl
• Aliases: IL-31R-beta, IL-31RB, OSMRB, OSMRbeta, PLCA1
• Gene name: oncostatin M receptor
• Alternate names: oncostatin-M-specific receptor subunit beta, IL-31 receptor subunit beta, IL-31R subunit beta, interleukin-31 receptor subunit beta, oncostatin-M specific receptor beta subunit,
• Gene location: 5p13.1 (38845857: 38945578)     Exons: 21     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the type I cytokine receptor family. The encoded protein heterodimerizes with interleukin 6 signal transducer to form the type II oncostatin M receptor and with interleukin 31 receptor A to form the interleukin 31 receptor, a
• OMIM: 608587

Protein Summary

• Protein general information: Q99650  
  • Name: Oncostatin M specific receptor subunit beta (Interleukin 31 receptor subunit beta) (IL 31 receptor subunit beta) (IL 31R subunit beta) (IL 31R beta) (IL 31RB)
  • Length: 979  
  • Mass: 110509
  • Tissue specificity: Expressed in keratinocytes (at protein level) (PubMed
• Sequence:

  MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIE
  TSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILF
  VFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEG
  MKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQ
  DSQETYNFTLIAENYLRKRSVNILFNLTHRVYLMNPFSVNFENVNATNAIMTWKVHSIRNNFTYLCQIELHGEGK
  MMQYNVSIKVNGEYFLSELEPATEYMARVRCADASHFWKWSEWSGQNFTTLEAAPSEAPDVWRIVSLEPGNHTVT
  LFWKPLSKLHANGKILFYNVVVENLDKPSSSELHSIPAPANSTKLILDRCSYQICVIANNSVGASPASVIVISAD
  PENKEVEEERIAGTEGGFSLSWKPQPGDVIGYVVDWCDHTQDVLGDFQWKNVGPNTTSTVISTDAFRPGVRYDFR
  IYGLSTKRIACLLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGYHVYLKSKARQCHPRF
  EKAVLSDGSECCKYKIDNPEEKALIVDNLKPESFYEFFITPFTSAGEGPSATFTKVTTPDEHSSMLIHILLPMVF
  CVLLIMVMCYLKSQWIKETCYPDIPDPYKSSILSLIKFKENPHLIIMNVSDCIPDAIEVVSKPEGTKIQFLGTRK
  SLTETELTKPNYLYLLPTEKNHSGPGPCICFENLTYNQAASDSGSCGHVPVSPKAPSMLGLMTSPENVLKALEKN
  YMNSLGEIPAGETSLNYVSQLASPMFGDKDSLPTNPVEAPHCSEYKMQMAVSLRLALPPPTENSSLSSITLLDPG
  EHYC

• Structural information:
  • Protein Domains: (335..42-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (433..52-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (529..62-)
    3 (/note="Fibronectin-type-III)
    (/e-)
  • Interpro: IPR003961  IPR036116  IPR003529  IPR013783  IPR040817  
  • Prosite: PS50853 PS01353
  • CDD: cd00063
  • STRING: ENSP00000274276
• Other Databases: GeneCards:  OSMR  Malacards:  OSMR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0043235	receptor complex	IBA	cellular component
GO:0038165	oncostatin-M-mediated signaling pathway	IBA	biological process
GO:0019955	cytokine binding	IBA	molecular function
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0008284	positive regulation of cell population proliferation	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0004924	oncostatin-M receptor activity	IBA	contributes to
GO:0004896	cytokine receptor activity	IBA	molecular function
GO:0004896	cytokine receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004924	oncostatin-M receptor activity	IDA	contributes to
GO:0038165	oncostatin-M-mediated signaling pathway	IMP	biological process
GO:0019838	growth factor binding	IPI	molecular function
GO:0002675	positive regulation of acute inflammatory response	IC	biological process
GO:0005900	oncostatin-M receptor complex	IDA	cellular component
GO:0034097	response to cytokine	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IGI	biological process
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway

Diseases

Associated diseases	References
Primary localized cutaneous amyloidosis	KEGG:H01217
Primary localized cutaneous amyloidosis	KEGG:H01217
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R