• Gene id: 91782

Gene Summary

• Gene Symbol: CHMP7   Gene   UCSC   Ensembl
• Gene name: charged multivesicular body protein 7
• Alternate names: charged multivesicular body protein 7, CHMP family, member 7, chromatin-modifying protein 7,
• Gene location: 8p21.3 (23243636: 23261999)     Exons: 11     NC_000008.11

Protein Summary

• Protein general information: Q8WUX9  
  • Name: Charged multivesicular body protein 7 (Chromatin modifying protein 7)
  • Length: 453  
  • Mass: 50911
• Sequence:

  MWSPEREAEAPAGGDPAGLLPPEWEEDEERMSFLFSAFKRSREVNSTDWDSKMGFWAPLVLSHSRRQGVVRLRLR
  DLQEAFQRKGSVPLGLATVLQDLLRRGELQRESDFMASVDSSWISWGVGVFLLKPLKWTLSNMLGDNKVPAEEVL
  VAVELLKEKAEEVYRLYQNSPLSSHPVVALSELSTLCANSCPDERTFYLVLLQLQKEKRVTVLEQNGEKIVKFAR
  GPRAKVSPVNDVDVGVYQLMQSEQLLSRKVESLSQEAERCKEEARRACRAGKKQLALRSLKAKQRTEKRIEALHA
  KLDTVQGILDRIYASQTDQMVFNAYQAGVGALKLSMKDVTVEKAESLVDQIQELCDTQDEVSQTLAGGVTNGLDF
  DSEELEKELDILLQDTTKEPLDLPDNPRNRHFTNSVPNPRISDAELEAELEKLSLSEGGLVPSSKSPKRQLEPTL
  KPL

• Structural information:
  • Interpro: IPR005024  
  • STRING: ENSP00000380794
• Other Databases: GeneCards:  CHMP7  Malacards:  CHMP7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000785	chromatin	IDA	colocalizes with
GO:0005515	protein binding	IPI	molecular function
GO:0000815	ESCRT III complex	NAS	cellular component
GO:0071168	protein localization to chromatin	IMP	biological process
GO:0031468	nuclear envelope reassembly	TAS	biological process
GO:1904903	ESCRT III complex disassembly	NAS	biological process
GO:0036258	multivesicular body assembly	NAS	biological process
GO:0039702	viral budding via host ESCRT complex	NAS	biological process
GO:0005771	multivesicular body	IBA	cellular component
GO:0009898	cytoplasmic side of plasma membrane	IBA	cellular component
GO:0000815	ESCRT III complex	IBA	cellular component
GO:0006900	vesicle budding from membrane	IBA	biological process
GO:0032511	late endosome to vacuole transport via multivesicular body sorting pathway	IBA	biological process
GO:0000815	ESCRT III complex	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0010458	exit from mitosis	IMP	biological process
GO:0031468	nuclear envelope reassembly	IMP	biological process
GO:0007034	vacuolar transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016197	endosomal transport	TAS	biological process
GO:0019058	viral life cycle	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005635	nuclear envelope	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0000815	ESCRT III complex	IDA	cellular component
GO:0007080	mitotic metaphase plate congression	IMP	biological process
GO:0061952	midbody abscission	IMP	biological process
GO:0006997	nucleus organization	IMP	biological process
GO:0045324	late endosome to vacuole transport	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04217	Necroptosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq