• Gene id: 9177

Gene Summary

• Gene Symbol: HTR3B   Gene   UCSC   Ensembl
• Aliases: 5-HT3B
• Gene name: 5-hydroxytryptamine receptor 3B
• Alternate names: 5-hydroxytryptamine receptor 3B, 5-HT3-B, 5-hydroxytryptamine (serotonin) receptor 3B, ionotropic, 5-hydroxytryptamine 3 receptor B subunit, serotonin-gated ion channel subunit,
• Gene location: 11q23.2 (19312145: 19302707)     Exons: 7     NC_000001.11
• Gene summary(Entrez): The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitoge
• OMIM: 604654

Protein Summary

• Protein general information: O95264  
  • Name: 5 hydroxytryptamine receptor 3B (5 HT3 B) (5 HT3B) (Serotonin receptor 3B)
  • Length: 441  
  • Mass: 50292
  • Tissue specificity: Expressed in the brain cortex, in the caudate nucleus, the hyppocampus, the thalamus and the amygdala. Detected in the kidney and testis as well as in monocytes of the spleen, small and large intestine, uterus, prostate, ovary and plac
• Sequence:

  MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAEN
  QILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSSGTIENYKPIQ
  VVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGG
  FAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTP
  LIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQP
  GTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSYLFMLGIYTITLCSLWALWGGV

• Structural information:
  • Interpro: IPR008132  IPR008134  IPR006202  IPR036734  IPR006201   IPR036719  IPR006029  
  • STRING: ENSP00000260191
• Other Databases: GeneCards:  HTR3B  Malacards:  HTR3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009986	cell surface	IDA	cellular component
GO:0050877	nervous system process	IBA	biological process
GO:0043005	neuron projection	IBA	cellular component
GO:0022850	serotonin-gated cation-selective channel activity	IBA	molecular function
GO:0007268	chemical synaptic transmission	IBA	biological process
GO:0007165	signal transduction	IBA	biological process
GO:0045202	synapse	IBA	cellular component
GO:0042391	regulation of membrane potential	IBA	biological process
GO:0034220	ion transmembrane transport	IBA	biological process
GO:0030594	neurotransmitter receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0005230	extracellular ligand-gated ion channel activity	IEA	molecular function
GO:0015276	ligand-gated ion channel activity	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0022850	serotonin-gated cation-selective channel activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:1904602	serotonin-activated cation-selective channel complex	IGI	cellular component
GO:0022850	serotonin-gated cation-selective channel activity	IGI	molecular function
GO:0007210	serotonin receptor signaling pathway	IEA	biological process
GO:0007210	serotonin receptor signaling pathway	IEA	biological process
GO:0007210	serotonin receptor signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04726	Serotonergic synapse
hsa04742	Taste transduction

Diseases

Associated diseases	References
Mental depression	PMID:16487942
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)