• Gene id: 91746

Gene Summary

• Gene Symbol: YTHDC1   Gene   UCSC   Ensembl
• Aliases: YT521, YT521-B
• Gene name: YTH domain containing 1
• Alternate names: YTH domain-containing protein 1, putative splicing factor YT521, splicing factor YT521, splicing factor YT521-B,
• Gene location: 4q13.2 (68350092: 68310386)     Exons: 17     NC_000004.12
• OMIM: 617283

Protein Summary

• Protein general information: Q96MU7  
  • Name: YTH domain containing protein 1 (Splicing factor YT521) (YT521 B)
  • Length: 727  
  • Mass: 84700
• Sequence:

  MAADSREEKDGELNVLDDILTEVPEQDDELYNPESEQDKNEKKGSKRKSDRMESTDTKRQKPSVHSRQLVSKPLS
  SSVSNNKRIVSTKGKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKRDPERRAKSPTPD
  GSERIGLEVDRRASRSSQSSKEEVNSEEYGSDHETGSSGSSDEQGNNTENEEEGVEEDVEEDEEVEEDAEEDEEV
  DEDGEEEEEEEEEEEEEEEEEEEEYEQDERDQKEEGNDYDTRSEASDSGSESVSFTDGSVRSGSGTDGSDEKKKE
  RKRARGISPIVFDRSGSSASESYAGSEKKHEKLSSSVRAVRKDQTSKLKYVLQDARFFLIKSNNHENVSLAKAKG
  VWSTLPVNEKKLNLAFRSARSVILIFSVRESGKFQGFARLSSESHHGGSPIHWVLPAGMSAKMLGGVFKIDWICR
  RELPFTKSAHLTNPWNEHKPVKIGRDGQEIELECGTQLCLLFPPDESIDLYQVIHKMRHKRRMHSQPRSRGRPSR
  REPVRDVGRRRPEDYDIHNSRKKPRIDYPPEFHQRPGYLKDPRYQEVDRRFSGVRRDVFLNGSYNDYVREFHNMG
  PPPPWQGMPPYPGMEQPPHHPYYQHHAPPPQAHPPYSGHHPVPHEARYRDKRVHDYDMRVDDFLRRTQAVVSGRR
  SRPRERDRERERDRPRDNRRDRERDRGRDRERERERLCDRDRDRGERGRYRR

• Structural information:
  • Protein Domains: (355..49-)
    (/note="YTH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00225"-)
  • Interpro: IPR007275  
  • Prosite: PS50882
  • PDB: 2YUD 4R3H 4R3I 6RT4 6RT5 6RT6 6RT7
  • PDBsum: 2YUD 4R3H 4R3I 6RT4 6RT5 6RT6 6RT7
  • STRING: ENSP00000339245
• Other Databases: GeneCards:  YTHDC1  Malacards:  YTHDC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990247	N6-methyladenosine-containing RNA binding	IBA	molecular function
GO:0048024	regulation of mRNA splicing, via spliceosome	IBA	biological process
GO:0005654	nucleoplasm	IBA	cellular component
GO:0003729	mRNA binding	IBA	molecular function
GO:0000398	mRNA splicing, via spliceosome	IBA	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IBA	biological process
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:0048024	regulation of mRNA splicing, via spliceosome	IDA	biological process
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:0009048	dosage compensation by inactivation of X chromosome	IDA	biological process
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:0048024	regulation of mRNA splicing, via spliceosome	IDA	biological process
GO:1990247	N6-methyladenosine-containing RNA binding	IDA	molecular function
GO:0006376	mRNA splice site selection	IDA	biological process
GO:0016607	nuclear speck	IDA	cellular component
GO:0006406	mRNA export from nucleus	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010608	posttranscriptional regulation of gene expression	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881