• Gene id: 9173

Gene Summary

• Gene Symbol: IL1RL1   Gene   UCSC   Ensembl
• Aliases: DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1
• Gene name: interleukin 1 receptor like 1
• Alternate names: interleukin-1 receptor-like 1, growth stimulation-expressed, homolog of mouse growth stimulation-expressed, interleukin 1 receptor-related protein,
• Gene location: 2q12.1 (102311501: 102352366)     Exons: 13     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the interleukin 1 receptor family. Studies of the similar gene in mouse suggested that this receptor can be induced by proinflammatory stimuli, and may be involved in the function of helper T cells. This gen
• OMIM: 601203

Protein Summary

• Protein general information: Q01638  
  • Name: Interleukin 1 receptor like 1 (EC 3.2.2.6) (Protein ST2)
  • Length: 556  
  • Mass: 63358
  • Tissue specificity: Highly expressed in kidney, lung, placenta, stomach, skeletal muscle, colon and small intestine. Isoform A is prevalently expressed in the lung, testis, placenta, stomach and colon. Isoform B is more abundant in the brain, kidney and t
• Sequence:

  MGFWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFL
  PAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKN
  CQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEV
  EIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQ
  YDCLALNLHGLRRHTVRLSRKNPIDHHSIYCIIAVCSVFLMLINVLVIILKMFWIEATLLWRDIAKPYKTRNDGK
  LYDAYVVYPRNYKSSTDGASRVEHFVHQILPDVLENKCGYTLCIYGRDMLPGEDVVTAVETNIRKSRRHIFILTP
  QITHNKEFAYEQEVALHCALIQNDAKVILIEMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNS
  KFWKHVRYQMPVPSKIPRKASSLTPLAAQKQ

• Structural information:
  • Protein Domains: (19..10-)
    1 (/note="Ig-like-C2-type)
    (114..19-)
    2 (/note="Ig-like-C2-type)
    (212..31-)
    3 (/note="Ig-like-C2-type)
    (375..53-)
    (/note="TIR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00204"-)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR013098  IPR003599   IPR003598  IPR015621  IPR004074  IPR000157  IPR035897  
  • Prosite: PS50835 PS50104
  • PDB: 4KC3
  • PDBsum: 4KC3
  • DIP: 37861
  • STRING: ENSP00000233954
• Other Databases: GeneCards:  IL1RL1  Malacards:  IL1RL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0002114	interleukin-33 receptor activity	IBA	molecular function
GO:0002113	interleukin-33 binding	IBA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0004908	interleukin-1 receptor activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0050135	NAD(P)+ nucleosidase activity	IEA	molecular function
GO:0061809	NAD+ nucleotidase, cyclic ADP-ribose generating	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0038172	interleukin-33-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002113	interleukin-33 binding	IEA	molecular function
GO:0050729	positive regulation of inflammatory response	IEA	biological process
GO:0090197	positive regulation of chemokine secretion	IEA	biological process
GO:0002826	negative regulation of T-helper 1 type immune response	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0032689	negative regulation of interferon-gamma production	IEA	biological process
GO:0032754	positive regulation of interleukin-5 production	IEA	biological process
GO:0043032	positive regulation of macrophage activation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006955	immune response	NAS	biological process
GO:0004896	cytokine receptor activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Idiopathic pulmonary fibrosis	PMID:14555548
Asthma	PMID:11463601
Asthma	PMID:21281963
Chronic obstructive pulmonary disease	PMID:19927353
Coronary artery disease	PMID:20602249
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray