• Gene id: 917

Gene Summary

• Gene Symbol: CD3G   Gene   UCSC   Ensembl
• Aliases: CD3-GAMMA, IMD17, T3G
• Gene name: CD3g molecule
• Alternate names: T-cell surface glycoprotein CD3 gamma chain, CD3g antigen, gamma polypeptide (TiT3 complex), CD3g molecule, epsilon (CD3-TCR complex), CD3g molecule, gamma (CD3-TCR complex), T-cell antigen receptor complex, gamma subunit of T3, T-cell receptor T3 gamma chain,
• Gene location: 11q23.3 (118344343: 118355160)     Exons: 7     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role
• OMIM: 186740

SNPs

rs700519

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000015.10   g.51215771G>A
NC_000015.9   g.51507968G>A
NG_007982.1   g.127828C>T
NM_000103.4   c.790C>T
NM_000103.3   c.790C>T
NM_031226.3   c.790C>T
NM_031226.2   c.790C>T
NM_001347255.2   c.790C>T
NM_001347255.1   c.790C>T
NM_001347256.2   c.790C>T
NM_001347256.1   c.

Protein Summary

• Protein general information: P09693  
  • Name: T cell surface glycoprotein CD3 gamma chain (T cell receptor T3 gamma chain) (CD antigen CD3g)
  • Length: 182  
  • Mass: 20469
• Sequence:

  MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLG
  SNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDK
  QTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN

• Structural information:
  • Protein Domains: (37..9-)
    (/note="Ig-like-)
    (149..17-)
    (/note="ITAM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00379"-)
  • Interpro: IPR015484  IPR036179  IPR013783  IPR032052  IPR003598   IPR003110  
  • Prosite: PS51055
  • PDB: 1SY6 6JXR
  • PDBsum: 1SY6 6JXR
  • STRING: ENSP00000431445
• Other Databases: GeneCards:  CD3G  Malacards:  CD3G

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045059	positive thymic T cell selection	IBA	biological process
GO:0004888	transmembrane signaling receptor activity	IBA	molecular function
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0030217	T cell differentiation	IBA	biological process
GO:0042105	alpha-beta T cell receptor complex	IBA	cellular component
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0061024	membrane organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042105	alpha-beta T cell receptor complex	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0042802	identical protein binding	IDA	molecular function
GO:0030159	signaling receptor complex adaptor activity	NAS	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0042608	T cell receptor binding	NAS	molecular function
GO:0015031	protein transport	IMP	biological process
GO:0007166	cell surface receptor signaling pathway	IMP	biological process
GO:0042110	T cell activation	NAS	biological process
GO:0070228	regulation of lymphocyte apoptotic process	IMP	biological process
GO:0042101	T cell receptor complex	NAS	cellular component
GO:0007163	establishment or maintenance of cell polarity	IMP	biological process
GO:0065003	protein-containing complex assembly	NAS	biological process
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0004888	transmembrane signaling receptor activity	IMP	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05166	Human T-cell leukemia virus 1 infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05169	Epstein-Barr virus infection
hsa05162	Measles
hsa04660	T cell receptor signaling pathway
hsa04659	Th17 cell differentiation
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05142	Chagas disease
hsa04658	Th1 and Th2 cell differentiation
hsa04640	Hematopoietic cell lineage

Diseases

Associated diseases	References
Combined immunodeficiency	KEGG:H00093
Combined immunodeficiency	KEGG:H00093
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881