• Gene id: 9168

Gene Summary

• Gene Symbol: TMSB10   Gene   UCSC   Ensembl
• Aliases: MIG12, TB10
• Gene name: thymosin beta 10
• Alternate names: thymosin beta-10, migration-inducing gene 12, migration-inducing protein 12,
• Gene location: 2p11.2 (84905655: 84906670)     Exons: 35     NC_000002.12
• OMIM: 188399

Protein Summary

• Protein general information: P63313  
  • Name: Thymosin beta 10
  • Length: 44  
  • Mass: 5026
• Sequence:

  MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS

• Structural information:
  • Interpro: IPR001152  IPR038386  
  • Prosite: PS00500
  • STRING: ENSP00000233143
• Other Databases: GeneCards:  TMSB10  Malacards:  TMSB10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042989	sequestering of actin monomers	IBA	biological process
GO:0030334	regulation of cell migration	IBA	biological process
GO:0003785	actin monomer binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0003785	actin monomer binding	IEA	molecular function
GO:0007015	actin filament organization	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005856	cytoskeleton	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881