• Gene id: 91663

Gene Summary

• Gene Symbol: MYADM   Gene   UCSC   Ensembl
• Aliases: SB135
• Gene name: myeloid associated differentiation marker
• Alternate names: myeloid-associated differentiation marker, myeloid upregulated protein,
• Gene location: 19q13.42 (53865627: 53876434)     Exons: 8     NC_000019.10
• OMIM: 609959

Protein Summary

• Protein general information: Q96S97  
  • Name: Myeloid associated differentiation marker (Protein SB135)
  • Length: 322  
  • Mass: 35274
  • Tissue specificity: Widely expressed. Not detected in thymus. {ECO
• Sequence:

  MPVTVTRTTITTTTTSSSGLGSPMIVGSPRALTQPLGLLRLLQLVSTCVAFSLVASVGAWTGSMGNWSMFTWCFC
  FSVTLIILIVELCGLQARFPLSWRNFPITFACYAALFCLSASIIYPTTYVQFLSHGRSRDHAIAATFFSCIACVA
  YATEVAWTRARPGEITGYMATVPGLLKVLETFVACIIFAFISDPNLYQHQPALEWCVAVYAICFILAAIAILLNL
  GECTNVLPIPFPSFLSGLALLSVLLYATALVLWPLYQFDEKYGGQPRRSRDVSCSRSHAYYVCAWDRRLAVAILT
  AINLLAYVADLVHSAHLVFVKV

• Structural information:
  • Protein Domains: (31..16-)
    (/note="MARVEL-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00581-)
    (168..31-)
    (/note="MARVEL-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00581"-)
  • Interpro: IPR008253  
  • Prosite: PS51225
  • STRING: ENSP00000375649
• Other Databases: GeneCards:  MYADM  Malacards:  MYADM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005911	cell-cell junction	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0034115	negative regulation of heterotypic cell-cell adhesion	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0034115	negative regulation of heterotypic cell-cell adhesion	IDA	biological process
GO:0030864	cortical actin cytoskeleton	IDA	cellular component
GO:0030864	cortical actin cytoskeleton	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0005911	cell-cell junction	IDA	cellular component
GO:0001726	ruffle	IDA	cellular component
GO:0090038	negative regulation of protein kinase C signaling	IMP	biological process
GO:0045217	cell-cell junction maintenance	IMP	NOT|biological process
GO:0005886	plasma membrane	IMP	cellular component
GO:1900026	positive regulation of substrate adhesion-dependent cell spreading	IMP	biological process
GO:0072659	protein localization to plasma membrane	IMP	biological process
GO:0030837	negative regulation of actin filament polymerization	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0031579	membrane raft organization	IMP	biological process
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0061028	establishment of endothelial barrier	IMP	biological process
GO:0010810	regulation of cell-substrate adhesion	IMP	NOT|biological process
GO:0001933	negative regulation of protein phosphorylation	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray