• Gene id: 9166

Gene Summary

• Gene Symbol: EBAG9   Gene   UCSC   Ensembl
• Aliases: EB9, PDAF
• Gene name: estrogen receptor binding site associated antigen 9
• Alternate names: receptor-binding cancer antigen expressed on SiSo cells, cancer-associated surface antigen RCAS1, estrogen receptor-binding fragment-associated gene 9 protein,
• Gene location: 8q23.2 (109539699: 109565995)     Exons: 8     NC_000008.11
• Gene summary(Entrez): This gene was identified as an estrogen-responsive gene. Regulation of transcription by estrogen is mediated by estrogen receptor, which binds to the estrogen-responsive element found in the 5'-flanking region of this gene. The encoded protein is a tumor-
• OMIM: 605772

Protein Summary

• Protein general information: O00559  
  • Name: Receptor binding cancer antigen expressed on SiSo cells (Cancer associated surface antigen RCAS1) (Estrogen receptor binding fragment associated gene 9 protein)
  • Length: 213  
  • Mass: 24377
  • Tissue specificity: Widely expressed. Expressed in ovary, testis, prostate, thymus, muscle and heart, but not in small intestine, colon, lymph nodes, or peripherical blood lymphocytes. The protein is not detected in any of the above organs.
• Sequence:

  MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEG
  GNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLD
  TWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS

• Structural information:
  • Interpro: IPR017025  
  • STRING: ENSP00000337675
• Other Databases: GeneCards:  EBAG9  Malacards:  EBAG9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030141	secretory granule	IBA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030141	secretory granule	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0016505	peptidase activator activity involved in apoptotic process	NAS	molecular function
GO:0001558	regulation of cell growth	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04915	Estrogen signaling pathway

Diseases

Associated diseases	References
Pre-eclampsia	PMID:17845206
Breast cancer	PMID:12160478
Ovarian cancer	PMID:15164121
Endometrial adenocarcinoma	PMID:16112719
Endometriosis	PMID:16112719
breast ductal carcinoma	PMID:12054692
invasive ductal carcinoma	PMID:11742495
Uterine cancer	PMID:16842844
cervical cancer	PMID:16112176
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)