• Gene id: 9162

Gene Summary

• Gene Symbol: DGKI   Gene   UCSC   Ensembl
• Aliases: DGK-IOTA
• Gene name: diacylglycerol kinase iota
• Alternate names: diacylglycerol kinase iota, DAG kinase iota, diglyceride kinase iota,
• Gene location: 7q33 (137846863: 137381036)     Exons: 37     NC_000007.14
• Gene summary(Entrez): This gene is a member of the type IV diacylglycerol kinase subfamily. Diacylglycerol kinases regulate the intracellular concentration of diacylglycerol through its phosphorylation, producing phosphatidic acid. The specific role of the enzyme encoded by
• OMIM: 604072

Protein Summary

• Protein general information: O75912  
  • Name: Diacylglycerol kinase iota (DAG kinase iota) (EC 2.7.1.107) (Diglyceride kinase iota) (DGK iota)
  • Length: 1065  
  • Mass: 116997
• Sequence:

  MDAAGRGCHLLPLPAARGPARAPAAAAAAAASPPGPCSGAACAPSAAAGAGAMNPSSSAGEEKGATGGSSSSGSG
  AGSCCLGAEGGADPRGAGSAAAAGAAALDEPAAAGQKEKDEALEEKLRNLTFRKQVSYRKAISRAGLQHLAPAHP
  LSLPVANGPAKEPRATLDWSENAVNGEHLWLETNVSGDLCYLGEENCQVRFAKSALRRKCAVCKIVVHTACIEQL
  EKINFRCKPTFREGGSRSPRENFVRHHWVHRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCKQAFHNKVTCF
  MLHHIEEPCSLGAHAAVIVPPTWIIKVKKPQNSLKASNRKKKRTSFKRKASKRGMEQENKGRPFVIKPISSPLMK
  PLLVFVNPKSGGNQGTKVLQMFMWYLNPRQVFDLSQEGPKDALELYRKVPNLRILACGGDGTVGWILSILDELQL
  SPQPPVGVLPLGTGNDLARTLNWGGGYTDEPVSKILCQVEDGTVVQLDRWNLHVERNPDLPPEELEDGVCKLPLN
  VFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTPKIQEL
  KFQCIVFLNIPRYCAGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASLAALQVGGHGERLHQCREVMLLTYKSI
  PMQVDGEPCRLAPAMIRISLRNQANMVQKSKRRTSMPLLNDPQSVPDRLRIRVNKISLQDYEGFHYDKEKLREAS
  ISDWLRTIAGELVQSFGAIPLGILVVRGDCDLETCRMYIDRLQEDLQSVSSGSQRVHYQDHETSFPRALSAQRLS
  PRWCFLDDRSQEHLHFVMEISQDEIFILDPDMVVSQPAGTPPGMPDLVVEQASGISDWWNPALRKRMLSDSGLGM
  IAPYYEDSDLKDLSHSRVLQSPVSSEDHAILQAVIAGDLMKLIESYKNGGSLLIQGPDHCSLLHYAAKTGNGEIV
  KYILDHGPSELLDMADSETGETALHKAACQRNRAVCQLLVDAGASLRKTDSKGKTPQERAQQAGDPDLAAYLESR
  QNYKVIGHEDLETAV

• Structural information:
  • Protein Domains: (372..50-)
    (/note="DAGKc-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00783"-)
  • Interpro: IPR002110  IPR020683  IPR036770  IPR017438  IPR037607   IPR000756  IPR001206  IPR016064  IPR002219  
  • Prosite: PS50297 PS50088 PS50146
  • STRING: ENSP00000288490
• Other Databases: GeneCards:  DGKI  Malacards:  DGKI

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004143	diacylglycerol kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0046339	diacylglycerol metabolic process	IBA	biological process
GO:0046486	glycerolipid metabolic process	IBA	biological process
GO:0046834	lipid phosphorylation	IBA	biological process
GO:0051966	regulation of synaptic transmission, glutamatergic	IBA	biological process
GO:0003951	NAD+ kinase activity	IEA	molecular function
GO:0004143	diacylglycerol kinase activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0007205	protein kinase C-activating G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004143	diacylglycerol kinase activity	IEA	molecular function
GO:0032991	protein-containing complex	IDA	cellular component
GO:0045202	synapse	IDA	cellular component
GO:0043197	dendritic spine	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030168	platelet activation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0004143	diacylglycerol kinase activity	IEA	molecular function
GO:2000300	regulation of synaptic vesicle exocytosis	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0017016	Ras GTPase binding	IEA	molecular function
GO:0007269	neurotransmitter secretion	IEA	biological process
GO:0004143	diacylglycerol kinase activity	IEA	molecular function
GO:0099147	extrinsic component of postsynaptic density membrane	IEA	cellular component
GO:0098891	extrinsic component of presynaptic active zone membrane	IEA	cellular component
GO:0097060	synaptic membrane	IEA	cellular component
GO:0060076	excitatory synapse	IEA	cellular component
GO:0048786	presynaptic active zone	IEA	cellular component
GO:0043679	axon terminus	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:1900452	regulation of long-term synaptic depression	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0051966	regulation of synaptic transmission, glutamatergic	IEA	biological process
GO:0046959	habituation	IEA	biological process
GO:0046579	positive regulation of Ras protein signal transduction	IEA	biological process
GO:0043087	regulation of GTPase activity	IEA	biological process
GO:0032045	guanyl-nucleotide exchange factor complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005095	GTPase inhibitor activity	IEA	molecular function
GO:0004143	diacylglycerol kinase activity	IDA	molecular function
GO:0046834	lipid phosphorylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0034260	negative regulation of GTPase activity	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04072	Phospholipase D signaling pathway
hsa04070	Phosphatidylinositol signaling system
hsa00564	Glycerophospholipid metabolism
hsa05231	Choline metabolism in cancer
hsa00561	Glycerolipid metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray